Al Quran Menyatakan Umat Khianati Ali Pasca Wafat Nabi SAW (Qs. Asy Syu’ara; ayat 205-207)



Oleh : Ustad Husain Ardilla

.

UMAT  KHiANATi  Ali  PASCA  NABi  SAW WAFAT

.

Qs. Al An’am ayat 65-67

Qs. 6:65. Katakanlah (Muhammad), “Dialah yang berkuasa mengirimkan azab kepadamu, dari atas atau dari bawah kakimu atau Dia mencampurkan kamu dalam golongan golongan (yang saling bertentangan) dan merasakan kepada sebagian kamu keganasan sebagian yang lain.” Perhatikanlah bagaimana Kami menjelaskan berulang ulang tanda tanda (kekuasaan Kami) agar mereka memahami (nya)

Qs. 6:66. Dan kaummu mendustakannya (azab) padahal (azab) itu benar adanya. Katakanlah (Muhammad), “Aku ini bukanlah penanggung jawab kamu”

Qs. 6:67. Setiap berita (yang dibawa oleh Rasul) ada (waktu) terjadinya dan kelak kamu akan mengetahui

Dikutip dari  “AL HiDAYAH ALQURAN TAFSiR PERKATA TAJWID KODE ANGKA PENERBIT KALiM”  yang disahkan DEPAG, halaman 136 :

Asbabun Nuzul Qs.6 : 65-67 : Zaid bin Aslam mengatakan bahwa Rasulullah SAW bersabda  kepada para sahabat, “Setelah kepergianku, janganlah kalian kembali menjadi kafir dengan saling membunuh diantara kalian”. Mereka berkata, “Kami bersaksi bahwa tidak ada Tuhan selain Allah dan sesungguhnya engkau adalah Rasul Nya. “Sebagian yang lain berkata, “ini tidak akan pernah terjadi untuk selamanya, yaitu saling membunuh diantara kita, sementara kita semua adalah muslim.” Maka turunlah ketiga ayat ini (HR. Ibnu Abi Hatim)

Wahai para pembaca…

Qs. Asy Syu’ara; ayat 205-207

Qs.26 : 205  : Maka bagaimana pendapatmu jika kepada mereka kami berikan kenikmatan hidup beberapa tahun,

Qs.26 : 206  : Kemudian datang kepada mereka azab yang diancamkan kepada mereka,

Qs.26 : 207  : Niscaya tidak berguna bagi mereka kenikmatan yang mereka rasakan

Dikutip dari  “AL HiDAYAH ALQURAN TAFSiR PERKATA TAJWID KODE ANGKA PENERBIT KALiM”  yang disahkan DEPAG, halaman  376 :

Asbabun Nuzul Qs.26 : 205-207 : Menurut Abu Jahdham, ketiga ayat ini diturunkan berkenaan dengan Rasulullah yang suatu ketika terlihat bingung dan gelisah. Para sahabat menanyakan hal itu. “Aku bermimpi, setelah aku wafat kelak, aku melihat musuhku yang ternyata adalah berasal dari umatku sendiri,” jawab Rasulullah (HR.ibnu Abi Hatim)

Wahai para pembaca…

DUA SUMBER PERBEDAAN AGAMA SAMAWI

 Kepemimpinan Penggantinya di khianati oleh sebagian umatnya

Golongan Suni :

                    Karena tidak mengakui pengangkatan Ali bin Abi Thalib sebagai Penerus/Pengganti Nabi Muhammad SAW dengan kedudukan Imam (pemimpin) bagi umat Islam, maka Golongan Suni berpandangan tidak ada perbuatan penghianatan terhadap kepemimpinan Penerus/-Pengganti Nabi Muhammad saw.

Pengangkatan Abu Bakar sebagai Khalifah setelah wafatnya Nabi Muhammad saw adalah sah karena didasarkan pada kesepakatan (musyawarah) umat Islam yang dilaksanakan di Saqifah, Balai Pertemuan Bani Saidah.

Golongan Syi’ah:

Pengangkatan Ali bin Abi Thalib sebagai Imam (pemimpin) umat Islam (setelah Nabi SAW) oleh Nabi Muhammad SAW sendiri di Gadhir Khum adalah merupakan ketetapan Nabi SAW yang wajib di taati. Jika kemudian segelintir umat Islam yang berkumpul di Balai Pertemuan Saqifah Bani Saidah, memilih Abu Bakar sebagai Khalifah pertama setelah wafatnya Nabi SAW, maka perbuatan itu merupakan pembangkangan terhadap Ketetapan Nabi Muhammad SAW serta merupakan pengkhianatan terhadap Ali bin Abi Thalib yang telah diangkat sebagai Pemimpin/Imam Umat Islam.

(Lihat Peristiwa Penolakan Bani Israel terhadap Pengangkatan Nabi Harun as sebagai Pengganti/Penerus Nabi Musa as pada Kemah Pertemuan Bani Korah)

Dengan demikian jika berpegang pada pandangan Golongan Suni, maka Nabi Muhammad SAW tidak memenuhi Aspek  persamaan dengan Nabi Musa as, karena tidak ada perbuatan penghianatan terhadap Pemimpin/Imam, sebab memang Beliau SAW tidak pernah mengangkat anggota keluarganya (Ali bin Abi Thalib as) sebagai Pemimpin/Imam umat Islam sepeninggal Nabi Muhammad SAW.

Kendati tak henti-hentinya Nabi saw. menasihati para sahabat dan umat Islam akan besarnya hak Ahlulbait as. atas mereka… kendati pesan demi pesan telah beliau sampaikan agar umat bersikap baik, medukung, membela dan menerima kepmipminan Ahlulbait as., namun pasan-pasan dan wasiat-wasiay Nabi saw. itu sepertinya tidak mendapat sambutan semestinya… mereka makin memebenci Imam Ali dan Ahlulbait Nabi saw., sampai-sampai seakan, andai Nabi saw. memerintahkan mereka untuk membencinya niscaya apa yang sudah mereka lakukan sudah melebihi dari cukup… Andai Nabi saw. memerintah mereka untuk mengkhianatinya niscaya pengkhianatan yang mereka lakukan sudah melebihi apa yang beliau perintahkan… mereka lebih memilih jalan pengkhianatan ketimbang kesetiaan… lebih menyukai jalan kebencian ketimbang kecintaan….

Kini Umat Mengkhianati Sang Imam as.!

Pengkhiatan itu begitu menyakitkan…. Karena ia akan membawa kesengsaraan dunia akhirat …. Pengkhianatan yang akan menghalangi sang Imam meberikan bimbingan keselamatan dan menghindarkan mereka dari kebinasaan… Karenanya, Imam Ali as. berulang kali mengatakan:

إنّه ممّا عهد إليّ النبي (صلى الله عليه وآله وسلم) أنّ الاُمّة ستغدر بي بعده

“Termasuk yang dijanjikan Nabi kepadaku bahwa umat akan mengkhianatiku sepeninggal beliau.”

Sumber Hadis:

Hadis ini telah diriwayatkan dan dishahihkan al Hakim dan adz Dzahabi. Ia berkata:

صحيح الاسناد

“Hadis ini sahih sanadnya.”

Adz Dzahabi pun menshahihkannya. Ia berkata:

صحيح

“Hadis ini shahih.” [1]

Sebagaimana juga diriwayatkan oleh Ibnu Abi Syaibah, al Bazzâr, ad Dâruquthni, al Khathib al Baghdâdi, al Baihaqi dkk.

Nabi saw. Mengabarkan Bahwa Umat Akan Menuangkan Kedengkian Mereka Kepada Imam Ali as.

Pengkhianatan itu akan mereka tuangkan dalam bentuk dendam kusumat terlaknat ke atas Imam Ali as. dan Ahlulbait Nabi saw. sepeninggal beliau.

Demikianlah, mereka yang memendam dendam kusumat dan kebencian kepada Nabi saw. akan menuangkannya kepada Imam Ali as., dan puncaknya akan mereka lakukan sepeninggal Nabi saw.

Kenyataan itu telah diberitakan Nabi saw. kepada Ali as. Para ulama meriwayatkan banyak hadis tentangnya, di antaranya adalah hadis di bawah ini:

Imam Ali as. berkata:

بينا رسول الله (صلى الله عليه وسلم) آخذ بيدي ونحن نمشي في بعض سكك المدينة، إذ أتينا على حديقة، فقلت: يا رسول الله ما أحسنها من حديقة ! فقال: إنّ لك في الجنّة أحسن منها، ثمّ مررنا بأُخرى فقلت: يا رسول الله ما أحسنها من حديقة ! قال: لك في الجنّة أحسن منها، حتّى مررنا بسبع حدائق، كلّ ذلك أقول ما أحسنها ويقول: لك في الجنّة أحسن منها، فلمّا خلا لي الطريق اعتنقني ثمّ أجهش باكياً، قلت: يا رسول الله ما يبكيك ؟ قال: ضغائن في صدور أقوام لا يبدونها لك إلاّ من بعدي، قال: قلت يا رسول الله في سلامة من ديني ؟ قال: في سلامة من دينك

“Ketika Rasulullah saw. memegang tanganku, ketika itu kami sedang berjalan-jalan di sebagian kampong kota Madinah, kami mendatangi sebuah kebun, aku berkata, ‘Wahai Rasulullah alangkah indahnya kebun ini!’ Maka beliau bersabda, ‘Untukmu di surga lebih indah darinya.’ Kemudian kami melewati tujuh kebun, dan setiap kali aku mengatakannya, ‘Alangkah indahnya’ dan nabi pun bersabda, ‘Untukmu di surga lebih indah darinya.’ Maka ketika kami berda di tempat yang sepi, Nabi saw. memelukku dan sepontan menangis. Aku berkata, ‘Wahai Rrasulullah, gerangan apa yang menyebabkan Anda menangis?’ Beliau menjawab, ‘Kedengkian-kedengkian yang ada di dada-dada sebagian kaum yang tidak akan mereka tampakkan kecuali setelah kematianku.’ Aku berkata, ‘Apakah dalam keselamatan dalam agamaku?’ Beliau menjawab, ‘Ya. Dalam keselamatan agamamu.’”

Sumber Hadis:

Hadis ini diriwayatkan oleh Abu Ya’la, al Bazzâr dengan sanad shahih, al Hakim dan adz Dzahabi dan mereka menshahihkannya,[2] Ibnu Hibbân dkk. [3]

Ia juga disebutkan oleh asy Syablanji dalam kitab Nûr al Abshârnya:88

Jadi jelaslah bagi kita apa yang sedang dialami oleh Imam Ali as. dari sebagian umat ini!

Imam Ali as. Mengeluhkan Pengkhianat Sahabat Dari Suku Quraisy dan Para Pendukungnya

Dalam banyak pernyataannya, Imam Ali as. mengeluhkan kedengkian, kejahatan dan pengkhianatan tokoh-tokoh suku Quraisy terhadap Nabi saw. yang kemudian, ketika mereka tidak mendapatkan jalan untuk meluapkannya kepada beliau saw., mereka meluapkan dendanm kusumat kekafiran dan kemunafikan kepadanya as.

Di bawah ini akan saya sebutkan sebuah kutipan pernyataan beliau as. tersebut.

اللهمّ إنّي أستعديك على قريش، فإنّهم أضمروا لرسولك (صلى الله عليه وآله وسلم) ضروباً من الشر والغدر، فعجزوا عنها، وحُلت بينهم وبينها، فكانت الوجبة بي والدائرة عليّ، اللهمّ احفظ حسناًوحسيناً، ولا تمكّن فجرة قريش منهما ما دمت حيّاً، فإذا توفّيتني فأنت الرقيب عليهم وأنت على كلّ شيء شهيد

“Ya Allah, aku memohon dari Mu agar melawan Quraisy, karena mereka telah memendam bermacam sikpa jahat dan pengkhianatan kepada Rasul-Mu saw., lalu mereka lemah dari meluapkannya, dan Engkau menghalang-halangi mereka darinya, maka dicicipkannya kepadaku dan dialamatkannya ke atasku. Ya Allah peliharalah Hasan dan Husain, jangan Engkau beri kesempatan orang-orang durjana dari Quraisy itu membinasakan keduanya selagi aku masih hidup. Dan jika Engkau telah wafatkan aku, maka Engkau-lah yang mengontrol mereka, dan Engkau Maha Menyaksikan segala sesuatu.”[4]

Coba Anda perhatikan pernyataan Imam Ali as. di atas, bagaimana dendam dan pengkhianatan Quraisy terhadap Nabi saw. akan mereka luapkan kepadanya! Dan di dalamnya juga terdapat penegasan bahwa mereka tidak segan-segan akan menghabisi nyawa bocah-bocah mungil kesayangan Rasulullah saw.; Hasan dan Husain as. yang akan meneruskan garis keturunan kebanian sebagai melampiasan dendam mereka kepada Nabi saw.!

Dalam salah sebuah pidatonya yang lain, Imam Ali as. mempertegas hal tersebut, beliau berkata:

وقال قائل: إنّك يا ابن أبي طالب على هذا الامر لحريص، فقلت: بل أنتم ـ والله ـ أحرص وأبعد، وأنا أخص وأقرب، وإنّما طلبت حقّاً لي وأنتم تحولون بيني وبينه، وتضربون وجهي دونه، فلما قرّعته بالحجة في الملا الحاضرين هبّ كأنه بهت لا يدري ما يجيبني به.

اللهم إني استعديك على قريش ومن أعانهم، فانهم قطعوا رحمي، وصغّروا عظيم منزلتي، وأجمعوا على منازعتي أمراً هو لي، ثم قالوا: ألا إنَّ في الحق أنْ تأخذه وفي الحق أن تتركه .

“Ada seorang berkata, ‘Hai putra Abu, Sesungguhnya engkau rakus terhadap urusan (Kekhalifahan) ini!’ Maka aku berkata, “Demi Allah, kalian-lah yang lebih rakus dan lebih jauh, adapun aku lebih khusus dan lebih dekat. Aku hanya meminta hakku, sedangkan kalian menghalang-halangiku darinya, dan menutup wajahku darinya. Dan ketika aku bungkam dia dengan bukti di hadapan halayak ramai yang hadir, ia terdiam, tidak mengerti apa yang harus ia katakan untuk membantahku.

Ya Allah, aku memohon pertolongan-Mu atas Quraisy dan sesiapa yang membela mereka, karena sesungguhnya mereka telah memutus tali kekerabatanku, menghinakan keagungan kedudukanku dan bersepakat merampas sesuatu yang menjadi hakku. Mereka berkata, ‘Ketahuilah bahwa adalah hak kamu untuk menuntut dan hak kamu pula untuk dibiarkan.”[5]

Coba Anda perhatikan pengkhianatan apa yang mereka lakukan… ketika Imam Ali as. berusaha mengambil kembali hak beliau yang mereka rampas, jusretu mereka menuduhnya rakus dan gila kekuasaan… sementara mereka yang merampas haknya merasa benar dan menjalanlan apa yang seharusnya mereka lakukan! Karenanya, kemudian beliau membungkam mulut khianat mereka dengan hujjah yang tak terbantahkan….


[1] Mustadrak al Hakim,3/140 dan 142.

[2] Al Mustadrak,3/139 hanya saja bagian akhir radaksi hadis ini terpotong, sepertinya ada “tangan-tangan terampil” yang sengaja menyensor hadis di atas.

[3]Teks hadis di atas sesuai dengan yang terdapat Majma’ az Zawâid,9/118.

[4] Syarah Nahjul Balaghhah, 20/298.

[5] Nahjul Balaghah, kuthbah ke.172

saudaraku….

Dialog Ibnu Abbas ra. Dan Sayyidina Umar Seputar Perampasan Hak Imamah Ali as.

Banyak spekulasi yang dipaksakan para ulama Sunni dalam menyikapi apa yang terjadi sesa’at setelah Nabi saw. wafat ketika para sahabat menyingkirkan Imam Ali as. dari hak kepemimpinan tertinggi umat Islam.. Mereka terpaksa mendustakan atau memalingkan ketegasan makna nash-nash penunjukan Imam Ali as. khususnya sabda Nabi saw. di Ghadir Khum, hanya karena satu alasan yaitu jika diterima kenyataan baahwa Nabi saw. telah menunjuk Ali sebagai Imam dan pemimpin tertinggi umat Islam sepeninggal beliau, mana mungkin para sahabat itu sepakat menentangnya?! Itu artinya kita menuduh para sahabat itu sebagai yang fasik karena terang-terangan menentang wasiat Nabi saw.

Tetapi jika kita mau jujur dalam melihat masalah ini, kita akan menyaksikan bahwa telah ada kesepakatan di balik meja antara para pembesar Quraisy (termasuk di antara mereka adalah para tokoh kafir Quraisy yang baru memeluk Islam karena terpaksa setelah kota Mekkah ditaklukkan dan juga sebagian sahabat lama dari suku Quraisy) yang akan berusaha sekuat tenaga untuk menyingkirkan Imam Ali as. dan bahkan siapapun dari suku bani Hasyim (sukunya Nabi saw.) dari tampuk kekuasaan khilafah… mereka hanya akan menggilir khilafah ini pada suku-suku Quraisy selain bani Hasyim…

Dialoq di bawah ini akan menjelaskan kenyataan adanya persekongkolan jahat tokoh-tokoh Quraisy… Dan dokumen ini sangat bernilai mengingat ia memuat pengakuan dari arsitek pembaiatan Saqifah yaitu sayyidina Umar ibn al-Khaththab…. Dan yang juga menentang penulisan wasiat keselamatan abadi yang hendak dituliskan Nabi saw di hari-hari akhir sebelum beliau meninggalkan umat Islam untuk selamanya…

Sayyidina Umar Membongkar Persekongkolan Quraisy Dalam Menyingkirkan Imam Ali as.

.

Ibnu Abil Hadid Al Mu’tazili dalam Syahr Nahjul Balaghah-nya dan Ibnu Al Atsir dalam al Kamil-nya menriwayatkan dialog panjang antara Sayyidinna Umar dan Ibnu Abbas ra. sebagai berikut:

Umar, “Hai Ibnu Abbas, tahukah kamu apa yang mendorong kaum Quraisy menolak kepemimpinan Ahlulbait sepeningal Muhammad?”

Ibnu Abbas, “Maka aku tidak ingin berterus terang dalam menjawab, lalu aku katakan kepada Umar, ‘Kalau saya tidak mengetahuinya, tentu Amirul Mu’minin mengetahuinya.’

Umar, Karena mereka (kaum Quraisy) tidak menyukai berkumpul kenabian dan kekhilafahan pada kalian (Bani Hasyim), sebab kalian akan menjadi congkak dan semena-mena tehadap kaum kalian. Oleh sebab itu kaum Quraisy memilih untuk mereka seorang pemimpin dan langkah itu benar dan sesuai ….. .

Ibnu Abbas“Apakah Amirul Mukminin bersedia menjauhkan dariku amarahnya lalu mendengarkan pembicaraan saya?”

Umar, “Ucapkan terserah kamu!”

Ibnu Abbas“Adapun ucapan Amirul Mukminin bahwa Quraiys membenci (berkumpulnya kenabian dan kekhilafahan pada bani Hasyim), maka sesungguhnya Allah –Ta’ala- telah berfirman :“Yang demikian itu adalah kerena sesungguhnya mereka benci kepada apa yang di turunkan Allah lalu Allah menghapus (pahal-pahala) amal –amal mereka ” (QS:47;9).

Adapun ucapan Anda, ‘Bahwa kami akan congkak. Maka jika kami bakal congkak dikarenakan jabatan khilafah maka sesungguhnya kami akan congkak dikarenakan kekerabatan kami (dengan Nabi saww), akan tetapi kami adalah kaum yang akhlak kami terbelah dari akhlak Rasulullah yang Allah berfirman tentangnya“Dan sesungguhnya kamu berada di atas akhlak(budi pekerti)  yang agung”(QS:68;4) dan Allah berfirman kepadanya: “Dan rendahkanlah dirimu terhadap orang-orang yang mengikutimu,yaitu orang-orang yang beriman “(QS:26;215).

Adapun ucapan Anda bahwa kaum Quraiys memilih …, maka Allah telah berfirman : “Dan Tuhanmu menciptakan apa yang Dia kehendaki dan memilih. Sekali-kali tidak ada pilihan bagi mereka”. (QS:28;68). Dan Anda –wahai Amirul Mukminin- mengetahui sesungguhnya Allah telah memilih dari hambaNya untuk jabatan itu .Dan andai kaum Quraisy berpendapat seperti yang ditetapkan Allah niscaya mereka tepat dan benar .

Umar, Tunggu, hai Ibnu Abbas, memang hati kalian Bani Hasyim enggan kecuali kebencian yang tiada padam dan kedengkian yang tiada berubah terhadap urusan kaum Quraisy.”

Ibnu Abbas, Tenang wahai Amurul Mukminin, jangan Anda menuduh hati Bani Hasyim dengan kedengkian, sebab hati mereka dari hati Rasulullah yang disucikan dari noda, mereka adalah Ahlulbait yang Allah berfirman kepada mereka: “Sesungguhnya Kami berkehendak untuk menghilangkan dari kalian rijs –wahai Ahlul-Bait dan mensucikan kalian sesuci-sucinya” .

Adapun ucapan Anda, “Mereka sakit hati. Maka benar, bagaimana seseorang yang miliknya dirampas dan melihat miliknya di tangan orang lain ia tidak sakit hati?!”

Umar“Adapun kamu hai Ibnu Abbas telah sampai kepada saya ucapanmu yang saya tidak suka memberitahukannya kepadamu, sebab akan menjatuhkan kedudukanmu disisiku.”

Ibnu Abbas“Apa itu wahai Amirul Mukminin, beritahukan kepadaku, kalua ia kebatilan maka orang seperti saya layak menjauhkan kebatilan dari dirinya dan jika ia haq maka kedudukanku disisi Anda tidak sepatutnya akan jatuh.”

Umar“Telah sampai kepadaku bahwa kamu senantiasa mengatakan: Perkara ini di rampas dari kami karena kedengkian (rasa hasut) dan dengan kezaliman.”

Ibnu Abbas, Adapun ucapan Anda ‘karena rasa hasut’, maka sesungguhnya Iblis telah mengahsut Adam sehingga mengeluarkannya dari surga dan kami adalah anak turun Adam yang di hasuti.

Adapun ucaapan Anda ‘dengan kezaliman’, maka sesungguhnya Amirul Mukminin mengatahui pemilik hak ini, siapa dia?

Kemudian Ibnu Abbas berkata, “Wahai Amirul Mukminin, bukankah bangsa Arab berhujjah atas orang ajam (non Arab) dengan kedudukan Rasulullah, dan suku Quraisy berhujjah atas seluruh bangsa Arab dengan kedudukan Rasulullah saww, maka kami lebih berhak terhadap Rasulullah dari seluruh Quraiys.”

Umar, Berdirilah sekarang dan pulanglah kerumahmu!”

Maka Ibnu Abbas berdiri dan ketika ia berjalan Umar memanggilnya, “Hai orang yang sedang berpaling, saya tetap seperti dulu, memelihara hakmu. Lalu Ibnu Abbas menoleh dan berkata, “Sesungguhnya saya punya hak atas Anda, wahai Amirul Mukminin dan atas seluruh kaum Muslimin dengan kedudukan Rasulullah saw., maka barang siapa memeliharanya berarti ia memelihara hak dirinya sendiri dan barang siapa menyia-nyiakannya maka ia menyia-nyiakannya. Kemudian ia berlalu, maka Umar berkata kepada mereka yang duduk bersamanya, “Aduh, Ibnu Abbas, tiada saya melihat ia berdebat dengan seorang kecuali ia mengalahkannya.[1]

.

Analisa Ringkas terhadap Dialoq diatas

Dari dialoq panjang antara Sayyidina Umar; arsitek pembaiatan Saqifah dan Ibnu Abbas ra. salah seorang keluarga besar Bani Hasyim yang dirampas hak kepemipimnanya oleh mereka yang merampasnya dapat Anda saksikan beberapa poin penting, di antaranya:

  • Umar berterus terang bahwa suku Quraisy benci pengaturan Tuhan yang menggabungkan kenabian dan khilafah pada keluarga Muahammad saww.
  • Pengaturan Tuhan mengandung arti menzalimi hak suku Quraisy –selain Bani Hasyim-, sebab Dia memberikan kepada Bani Hasyim kenabian dan khilafah, sementara  yang lainnya tidak kebagian keutamaan tersebut.
  • Kendati hal itu adalah ketetapan Tuhan akan tetapi kalangan Quraisy menolak penggabungan kenabian dan khilafah dengan alasan bahwa ketetapan itu akan menyebabkan Bani Hasyim akan merasa congkak dan angkuh.
  • Khalifah Umar membekukan ketentuan Tuhan yang menetapkan hak kenabian dan khilafah bagi Bani Hasyim dan menyajikan konsep alternatif yang mencabut dari mereka hak khilafah  dan ia menyebutnya sebagai tindakan benar dan lurus.
  • Khalifah menuduh banwa Bani Hasyim curang dan dengki terhadap suku-suku Quraisy lain, sebab mereka berusaha mengambil kembali khilfaha dari Quraisy.
  • Khalifah memposisikan dirinya sebagai jubir resmi pihak Quraisy dan sekaligus sebagai pembela kepentingan-kepentingannya.
  • Orang pertama dari kalangan Quraisy yang melahirkan alasan-alasan tersebut dan menyatakannya serta merancang kekuasaan Quraisy adalah Umar bin Khaththab. jadi beliau adalah anak Quraisy yang bakti dan perancang konsep alternatif.
  • Khalifah Umar selalu mewaspadai semua keluarga besar Bani Hasyim dan khawatir mereka mengambil kembali kekuasaan khilafah dari Quraisy. Adapun sikap akrabnya terhadap Ibnu Abbas adalah mata rantai sikap politis yang bertujuan memecah belah kesatuan Bani Hasyim yang selalu setia mendukung Imam Ali as., sebagaimana sebelumnya mereka lakukan terhadap Abbas dengan menawarkan jabatan agar ia meninggalkan Ali as akan tetapi tawaran itu ditolak mentah-mentah oleh Abbas paman Nabi tersebut.

.

Tanggapan Ibnu Abbas ra. Terhadap Sikap Sayyidina Umar

  • Sesungguhnya suku-suku Quraisy, diantara mereka adalah Umar sendiri benci terhadap ketetapan Allah Swt.dengan dipilihnya Ahlulbait as. sebagai pemimpin umat Islam.
  • Sesungguhnya suku-suku Quraisy menyimpang dari kebenaran syar’iyah dan salah karena memilih selain yang di pilihkan Allah.
  • Sesungguhnya kekhawatiran Quraisy terhadap kecongkakan Bani Hasyim apabila kenabian dan khilafah ditangan meraka, walau hal itu adalah ketetapan Allah, sama sekali tidak beralasan, baik alasan syar’iyah maupun berdasar logika.
  • Suku-suku Quraisy dalam sikap politis mereka dengan meninggalkan pilihan Allah dan menentukan pilihan mereka sendiri adalah bertentangan dengan ketetapan syar’iyah. Meraka mengatakan bahwa sikap itu benar dan menuduh Ahlulbait as.yang disucikan Allah sesuci-sucinya yang berusaha mengambil kembali hak mereka yang terampas sebagai berbuat curang dan memendam rasa hasut.
  • Ibnu Abbas ra. menjelaskan bahwa Umar telah mengetahui siapa sebenarnya pemilik hak khilafah itu, yaitu Ali as. namun kendati demikian mereka merampasnya.
  • Sesungguhnya suku Quraisy mendengki dan menzalimi Ahlul-Bait as dengan merampas hak khilafah dari mereka.
  • Sesungguhnya mereka yang menyia-nyiakan hak Ahlulbait as dalam kepemimpinan umat sebenarnya meraka menzalimi diri mereka sendiri!

.

Ketidak Sukaan Suku Quraisy Terhadap Kepemiminan Ali as. Didasari Oleh Kebencian!

Dokumen dan ketarangan di bawah akan memperjelas kenyataan di atas dan sekaligus mengungkap latar belakang perampasan hak kepemimpinan Imam Ali as. yang dilakukan ooleh tokoh-tokoh Quraisy.

Kebencian bangsa Arab dan khususnya suku Quraisy terhadap Imam Ali as. adalah dikarenakan pembelaan beliau terhadap Nabi saww. dan agama Islam, sehingga dengan ketajaman pedang Ali as., musuh-musuh Islam dikalahkan, dan korban dari kalangan merekapun berjatuhan, sehingga walaupun di kemudian hari mereka memeluk Islam rasa dengki dan dendam tersebut masih ada dalam hati mereka. Apalagi mereka yang memeluk Islam bukan karena ketulusan akan tetapi karena tujuan-tujuan lain seperti: karena ikut-ikutan, menginginkan mendapatkan materi, takut terhadap kejayaan Islam dan lain lain .

Ibnu Abi al Hadid mengatakan, “Ketahuilah bahwa semua darah yang ditumpahkan Rasulullah saw. dengan pedang Ali as. dan dengan pedang yang lainnya maka orang-orang Arab sepeninggal Nabi saw. hanya akan menuntut balas semua itu kepada Ali as., dan itu adalah kebiasaan bangsa Arab apabila ada seorang dari mereka terbunuh mereka menuntut balas kepada si pembunuhnya dan apabila ia telah mati atau ada halangan untuk membalasnya maka mereka akan membalas keluarga yang paling sepadan dengan si pembunuh dari keluargnya.” [2]

Dan selain itu kedengkian itu pada sebagain mereka di kerenakan rasa iri dan hasut terhadap berbagai keistimewaan dan keutamaan Imam Ali as. yang selalu diutarakan dan di tablighkan Nabi Muhammad saww. serta kedudukan sentral yang di berikan kepada beliau as. Dan perlu di ketahui bahwa suku Quraisy adalah terkenal dengan rasa hasut dan iri serta kompetisi tidak sehat diantara mereka, sebagaimana di tegaskan oleh Khalifah Umar  kepada Abu Musa al-’Asy’ari dan Mughirah bin Syu’bah.[3]

.

Bukti-bukti Adanya Kedengkian Suku Quraisy Terhadap Imam Ali as. dan Ahlulbait as.

Dalam sebuah hadis  dari Abu Utsman an Nahdi dari Ali as. beliau berkata, “Pada suatu hari Nabi saww. memelukku sambil menangis tersedu-sedu, maka saya bertanya kepada beliau: Gerangan apa yang menyebabkan Anda menangis, wahai Rasulullah? Beliau bersabda, ‘Kedengkian terhadapmu yang ada di dada-dada beberapa kaum yang tidak akan mereka tampakkan kecuali setelah kematianku.

Saya bertanya, ‘Wahai Rasulullah, apakah dalam keselamatan agamaku?’

Beliau menjawab, ‘Ya, dalam keselamatan agamamu.’” [4]

.

Ibnu Abi al Hadid setelah membenarkan sikap Imam Ali as. bergabung dengan dewan syura yang di bentuk oleh Umar kendati beliau tahu bahwa tidak akan terpilih dan Abbas pun telah menyarankan agar beliau tidak terlibat dalam dewan tersebut, karena menurut hemat Ibnu Abi al Hadid dengan tidak ikut sertanya beliau dalam dewan itu akan menggembirakan hati kaum Quraisy sebab, “Quraisy sangat membenci Ali as.”[5]

Dalam kesempatan lain ia mengemukakan, “Ketahuilah bahwa keadaan Ali dalam hal ini (kebencian bangsa Arab terhadapnya) sangat masyhur dan tidak perlu di perpanjang lagi , tidakkah Anda menyaksikan bagaiamana pemberontakan bangsa Arab dari berbagai penjuru ketika beliau di baiat sebagai khialifah setelah dua puluh lima tahun dari wafat Nabi saw. dan semestinya dalam kurun waktu kurang dari itu kedengkian itu sudah terlupakan, tuntutan balas dendam sudah padam  dan hati-hati yang membara meredah serta terhibur, berlalunya sebuah generasi dan datangnya generasi baru dan tidak tersisa dari generasi menyandang dendam kecuali sebagaian kecil, namun demikian keadaan beliau dengan suku Quraisy setelah kurun waktu yang panjang itu seperti keadaan beliau apabila menerima jabatan khilafah langsung sepeninggal anak pamannya (Nabi) saww. dalam sisi penampakan apa yang terpendam dalam jiwa dan gejolak hati, sehingga generasi pelanjut Quraisy dan para pemuda yang tidak ikut serta menyaksikanperistiwa-peristiwa yang dilakuakan Ali as.dan penghunusan pedang terhadap pendahulu dan ayah-ayah mereka juga melakukan apa-apa yang seandainya  para pendahulu itu masih hidup tidak akan melakukan seperti itu. Lalu apa bayangan kita kalau beliau duduk di kursi khilafah sementara pedang beliau masih bercucuran darah bangsa Arab, khususnya Quraisy… [6]

Dan inilah salah satu bentuk penghianatan umat terhadap beliau seperti yang di sabdakan Nabi saww. kepada Ali as.

Habib bin Tsa’labah bin Yazid berkata : Saya mendengar Ali berkata ketika dipaksa memberi baiat untuk Abu Bakar, “Demi Tuhan langit dan bumi (beliau ucapkan tiga kali), sesungguhnya ini adalah janji Nabi yang ummi kepadaku, “Bahwa umat akan berkhianat terhadapmu sepeninggalku.[7]

.

Beberapa bukti adanya kebencian sahabat terhadap Imam Ali as.

Dalam banyak riwayat dapat kita temukan bukti adanya rasa dengki dan kebencian sebagian sahabat Nabi saww. terhadap Imam Ali as. walaupun Nabi saww. dalam banyak kesempatan telah menegaskan bahwa kebencian terhadap Imam Ali as. adalah kemunafikan. Dibawah ini akan kami sebutkan beberapa riwayat hadis yang membuktikan adanya kebencian itu .

Para muhadis seperti at-Turmudzi, ath-Thabarani, an-Nasa’i dan lain-lain meriwayatkan beberapa hadis yang menyebutkan bahwa ada sekelompok sahabat yang bersekongkol menyampaikan keluhan tentang sikap Ali as. kepada Nabi saww. ketika menjadi komandan pasukan yang di kirim ke negri Yaman dengan tujuan menjatuhkan kedudukan Ali as. di hadapan Nabi saww., melihat tindakan mereka Nabi saww. marah dan menegur mereka agar tidak membenci Ali as. seraya menegaskan bahwa Ali adalah wali mereka sepeninggal Nabi saww.

Setiap kali mereka mengeluhkan tetntang Ali as. Nabi saww. mengatakan kepada mereka dengan nada marah : Apa yang kalian maukan dari Ali? Apa yang kalian maukan dari Ali? Dia adalah pemimpin kalian setelahku . [8]

Dalam riwayat lain di katakan: “Maka Khalid bin walid [9] menulis sepucuk surat kepada Nabi saww. dan memerintah saya  (Buraidah) untuk mengecam Ali, maka saya serahkan surat itu dan saya kecam Ali ra. maka tiba–tiba berubahlah wajah Rasulullah saww. dan bersabda: Janganlah kamu membenci Ali sesungguhnya Ali dariku dan aku dari Ali dan dia adalah wali(pemimpin) kalian setelahku.” [10]

Dalam riwayat lain disebutkan: “Buraidah berkata: Maka Khalid memanggilku dan mengatakan manfa’atkan kesempatan ini dan beritakan kepada Nabi saww apa yang ia lakukan, maka saya berangkat kembali ke Madinah dan sesampainya di madinah saya menuju masjid dan ketika itu Rasulullah saww. sedang berada dirumahnya sementara sekelompok sahabat beliau di hadapan pintu rumah beliau. Mereka bertanya: Ada berita apa hai Buraidah? Saya menjawab: baik, Allah memenangkan kaum muslimin. Mereka bertanya lagi, “Lalu apa yang membawamu pulang? Saya menjawab : Ali mengambil seorang tawanan wanita dari bagaian khumus dan saya datang untuk melaporkan hal itu kepada Nabi saw.”.

Mereka serempak menjawab, “Ya, beritahukan kepada Nabi saw. agar ia jatuh di mata Nabi saw. Sementara itu Rasulullah mendenganrkan pembicaraan mereka, lalu beliau keluar dengan muka marah dan bersabda: Mengapakah gerangan ada sekelompok kaum mencela-cela Ali? Barang siapa mencela-cela Ali berarti ia mencela saya dan barang siapa meninggalkan Ali berarti telah meninggalkan saya .Sesungguhnya Ali dariku dan aku dari Ali  … .”[11]


[1] Syarah Nahj: jilidIII\12\107, Tarikh Thabari: 4\223 dan  Al Kamil Fit Tarikh: 3\62 (peristiwa tahun 23).

[2] Syarah Najh :jilid III\juz:13 hal:283.

[3] Baca dialoq lengkap mereka dalam Syarah Nahjul Balaghah :jilid:I juz 2\125-126, dan dalam dialoq tersebut Umar menegaskan bahwa yang paling hasut diantara suku Quraisy adalah Abu Bakar.

[4] Nuur al-Abshar (asy-Syablanji asy-Syafi’i):88.Cetakan Daar al-Fikr.

[5] Syarah Najh :jilid III\juz:13 hal:283.

[6] Syarah Najh :jilid III\juz:13 hal:38.

[7] Syarah Najh :jilid II\juz6 hal:18 .

[8] Hadis riwayat an-Nasa’i dalam Khashaish(dengan komentar Abu Ishaq al-hawaini) diterbitkan Daar al-Baaz Makkah ,hadis nomer 84 dengan sanad Shahih .

[9] dalam espedisi tersebut Nabi saww. mengirim dua pasukan ,satu di bawah pimpinan Khalid dan yang lain di bawah pimpinan Imam Ali as. dan Nabi saww.mengatakan : Jika kalian bertemu maka Alilah pimpinan tunggal atas pasukan itu dan jika kalian berpisah maka setiap pasukan di bawah pimpinan masing-masing ,dan sesampainya di Yaman mereka bertemu .(An-Nasa’i: hadis ke 85).

[10] Ibid. hadis nomer:85 denagn sanad hasan .

[11] Majma’ az Zawaid ;al-Haitsami,9\18 dari riwayat ath-Thabarani dalam Mu’jam Ausath

saudara pembaca…

—————————————

Berikut saya jabarkan 9 persamaan aspek kenabian Nabi Musa dan nabi Muhammad SaaW.

Aspek Kenabian Musa as
1 . Nabi, Rasul & Imam
2 . Membawa Kitab Taurat untuk Bangsa Israel.
3. Bermigrasi/Hijrah
4. Menghadap Tuhan untuk menerima perintah-Nya bagi bangsa Israel
5. Mengangkat Mantan Hamba Sahayanya menjadi Panglima Militer sebelum wafat- nya.
6. Mengangkat seorang anggota Keluarga-nya menjadi Penggantinya (Wasiy) dan sebagai Imam Pertama bagi umatnya
7. Mempunyai 12 orang Imam, dan salah satunya yang menjadi Imam Besar berasal dari keturunan Penggantinya
8. Penggantinya dan keturunannya di sucikan untuk menjadi Imam Besar Bangsa Israel
9. Kepemimpinan Penggantinya di khianati oleh sebagian umatnya

Aspek kenabian Nabi Muhammad sebagai mesiah universal
1. Nabi, Rasul, Imam dan Tuan para Nabi & Rasul/Nabi Penutup
2. Membawa Kitab Baru dari Tuhan sebagai Perjanjian Baru untuk seluruh umat manusia
3. Bermigrasi/Hijrah
4. Menghadap Tuhan untuk menerima PerintahNya bagi seluruh umat manusia.
5. Mengangkat Mantan Hamba Sahayanya menjadi Panglima Militer sebelum wafat nya.
6. Mengangkat serang anggota keluarganya sebagai penggantinya dan sebagai imam pertama bagi umatnya
7. Mempunyai 12 orang Imam dari keturunan Penggantinya
8. Penggantinya dan keturunannya di sucikan untuk menjadi Imam Universal.
9. Kepemimpinan Penggantinya di khianati oleh sebagian umatnya

Dikarenakan adanya perbedaan pandangan antara kedua golongan Islam (Sunni dan Syi’ah), maka umat Islam hanya sepakat bulat dalam pemenuhan Aspek ke-1 s/d ke-5 dari persamaan antara Nabi Muhammad SAW dan Nabi Musa as, yaitu:

Aspek-1 : Muhammad SAW adalah Nabi, Rasul, Imam dan Tuan para Nabi & Rasul/Nabi Penutup.
Muhammad itu sekali-kali bukanlah bapak dari seorang laki-laki di antara kamu, tetapi dia adalah Rasulullah dan penutup nabi-nabi. Dan adalah Allah Maha Mengetahui segala sesuatu.(QS. Al Ahzab [33] : 40).

Aspek-2 : Nabi Muhammad SAW membawa Al Qur’an yang bersisikan hukum/ perjanjian baru bagi seluruh umat Manusia.
Maha Suci Allah yang telah menurunkan Al-Furqaan (Al Qur’an) kepada hamba-Nya, agar dia menjadi pemberi peringatan kepada seluruh alam,
(QS. Al Furqon [25] : 1)

Dan Kami turunkan kepadamu Al Qur’an, agar kamu menerangkan kepada umat manusia apa yang telah diturunkan kepada mereka dan supaya mereka memikirkan,….(QS. An Nahl [16]: 44)

Aspek-3 : Nabi Muhammad SAW berhijrah dari Mekkah ke Madinah
Hai Nabi, …………..…… yang turut hijrah bersama kamu ………… Dan adalah Allah Maha Pengampun lagi Maha Penyayang.
(QS. Al Ahzab [33]: 50)

Aspek-4 : Nabi Muhammad SAW menghadap langsung Allah SWT di dalam peristiwa Isra Mi’raj.

Aspek-5 : Nabi Muhammad SAW beberapa saat menjelang kewafatannya mengangkat mantan hamba sahayanya yaitu “Zayd bin Haritzah” sebagai Panglima Pasukan, tetapi didalam pertempuran awal Zayd bin Haritzah gugur/syahid, kemudian didalam keadaan sakit yang semakin parah, Beliau SAW mengangkat Usamah bin Zayd (anak laki-2 Zayd bin Haritzah) yang masih berumur 18 tahun sebagai Panglima Pasukan menggantikan bapaknya yang mantan hamba sahaya Nabi Muhammad SAW.

Tindakan Nabi Muhammad SAW mengangkat Zayd bin Haritzah maupun Usamah bin Zayd mengundang tanda-tanya besar (kalau tidak bisa dikatakan sebagai protes halus) dikalangan para Sahabat Beliau SAW, karena masih banyak di antara para Sahabat yang berdasarkan kemampuan berperang berada jauh di atas kemampuan Zayd dan Usamah. Apalagi mengingat usia Usamah masih sangat muda untuk diangkat sebagai Panglima Pasukan.

Ke-engganan umat Islam untuk bergabung kedalam pasukan Usamah, sampai2 menyebabkan Nabi Muhammad SAW dalam keadaan sakit yang semakin parah dan hanya beberapa hari saja menjelang Beliau SAW dipanggilan ke Rahmatullah, terpaksa keluar dari kamarnya dengan dipapah dan naik ke mimbar masjid untuk berpidato menegaskan kembali akan keputusan-nya mengangkat Usamah sebagai Panglima dan memerintahkan agar pasukan Usamah segera berangkat

.
Banyak sekali umat Islam, bahkan sampai masa kini, tidak memahami latar belakang keputusan Nabi Muhammad SAW untuk mengangkat Zayd bin Haritzah dan Usamah bin Zayd sebagai Panglima Pasukan Islam, sampai2 Beliau SAW dalam keadaan sakit yang semakin parah dan hanya beberapa hari saja menjelang kewafatannya, bersikap sangat gigih mempertahankan keputusannya itu.

Tetapi jika masalah ini dilihat dari sisi Nubuat Mesianistik, khususnya berkaitan dengan Aspek Ke-5 kesamaan dengan Nabi Musa as, maka sesungguhnya sangat jelas latar belakang keputusan Nabi Muhammad SAW di dalam mengangkat Zayd bin Haritzah dan Usamah bin Zayd, yaitu Nabi Muhammad SAW se-mata2 ingin menyatakan dan membuktikan bahwa Beliau adalah sama seperti Nabi Musa as, yang menjelang kewafatannya juga mengangkat mantan hamba sahayanya menjadi Panglima Pasukan, yaitu Yusya bin Nun (Yoshua bin Nun/Nabi Dzulkifli).

Aspek -6 :Mengangkat seorang anggota Keluarganya menjadi Penggantinya/ Penerusnya (Wasiy) dan sebagai Imam Pertama bagi umatnya.

Golongan Suni :
Sekalipun mengakui adanya hadisth Nabi Muhammad SAW yang berbunyi : “Hai Ali !, Tidakkah kamu menyukai (kedudukanmu) dariku seperti kedudukan Harun as dari Musa?”
Namun hadist ini tidak dimaknai sebagai pengangkatan Ali bin Abi Thalib (sepupu dan menantu Nabi SAW) menjadi Pengganti/Penerus (Wasiy) Nabi Muhammad SAW. Golongan Suni sama sekali tidak mengakui kedudukan Ali Bin Abi Thalib sebagai Wasiy Nabi SAW, bahkan menurut mereka Wasiy Nabi SAW adalah seseorang yang dipilih/diangkat atas kesepakatan umat, dan yang pertama adalah Abu Bakar yang dipilih/diangkat di Balai Pertemuan Bani Saidah di Saqifah. Dengan demikian secara tidak disadari mereka telah menolak kemesiahan universal Nabi Muhammad Saaw.

Golongan Syi’ah:
Hadisth Nabi Muhammad SAW yang berbunyi : “Hai Ali !, Tidakkah kamu menyukai (kedudukanmu) dariku seperti kedudukan Harun as dari Musa?”, dimaknai sebagai isyarat dari Nabi Muhammad SAW bahwa Ali bin Abi Thalib adalah merupakan Penerus/Pengganti (wasiy) Beliau SAW untuk memimpin umat sebagai Imam Pertama.

Isyarat hadist di atas kemudian diwujudkan oleh Nabi Muhammad SAW sepulangnya dari Haji Wada ditengah perjalanan menuju Madinah disuatu perempatan yang dinamakan Gadhir Khum, pada tanggal 18 Dzulhijjah 10 H, dihadapan 120.000 umat Islam, berupa pengangkatan resmi Ali bin Abi Thalib sebagai Penerus/Pengganti (Wasiy) Nabi SAW sebagai pemimpin umat (Imam) setelah Nabi SAW.

Peristiwa Ghadir Khum di riwayatkan oleh 110 perawi hadist dan dimuat oleh ratusan kitab hadist baik dari Golongan Suni maupun Golongan Syi’ah. Tetapi anehnya tidak termuat di dalam 6 Kitab Hadist (Kuttubus Sittah) yang diakui oleh Golongan Suni sebagai kitab2 hadist yang sahih dan boleh dijadikan pegangan. Padahal Hadist Gadhir Khum ini merupakan Hadist Sahih yang Muttawatir (artinya kebenaran-nya dianggap mutlak karena diriwayatkan oleh banyak jalur perawi yang dipercaya)

Dengan demikian jika berpegang pada pandangan Golongan Suni, maka Nabi Muhammad SAW tidak memenuhi Aspek ke-6 dari persamaan dengan Nabi Musa, karena Beliau SAW tidak mengangkat anggota keluarganya sebagai Pemimpim/Imam umat Islam. Sedangkan menurut pandangan Golongan Syi’ah justru sebaliknya, bahwa Nabi Muhammad SAW telah memenuhi Aspek ke-6 dari persamaan dengan Nabi Musa, dengan mengangkat Ali bin Abi Thalib sebagai Wasiy Beliau SAW.

Bahwasanya Golongan Suni tidak mengakui pengangkatan Ali bin Abi Thalib tersebut, tidaklah menjadikan pengangkatan itu menjadi tidak ada. Karena bukti hadist dan sejarah tetap menunjukkan Nabi Muhammad SAW telah mengangkat salah seorang anggota keluarga-nya sebagai Penerus/Pengganti/Wasiy dan Imam Pertama bagi umatnya.

Aspek-7: Mempunyai 12 orang Imam dari keturunan Penggantinya

Golongan Suni :
Sekalipun mengakui adanya Hadisth tentang 12 Imam sebagai hadist yang sahih dan muttawatir, tetapi berpendapat bahwa pengangkatan ke-12 Imam ini adalah berdasarkan pemilihan/kesepakatan umat Islam.

Tetapi kemudian Golongan Suni mengalami kesulitan karena tidak bisa menyebutkan/menetapkan siapakah ke duabelas Imam itu, bahkan sampai ada yang nekat memasukkan yazid bin muawiyah sebagai salah satu dari 12 imam padahal ia termasuk orang yang zalim. Akhirnya Hadist 12 Imam ini tidak pernah lagi dimunculkan dalam syariat maupun aqidah Suni.

Golongan Syi’ah :
Sebaliknya Golongan Syi’ah mengakui adanya 12 Imam setelah Nabi Muhammad SAW sebagai pemimpin umat. Hanya saja berbeda dengan 12 Imam pada Nabi Musa as (Bani Israel) yang keberadaannya sekaligus 12 Imam (horizontal) pada setiap masa, maka 12 Imam pada Nabi Muhammad SAW adalah berurut kebawah (vertikal), sesuai dengan ruang-lingkup waktu misi Nabi Muhammad SAW sebagai Mesiah Universal di akhir jaman.

Adapun ke 12 Imam menurut pandangan Syiah adalah :
1. Imam ‘Ali bin Abu Thalib as – Amirul mukminin Ash Shidiq Al Faruq
2. Imam Hasan as – Al Mujtaba
3. Imam Husein as – Sayyidu Syuhada
4. Imam ‘Ali bin Husein as – As Sajjad Zainal Abidin
5. Imam Muhammad bin ‘Ali as – Al Baqir
6. Imam Ja’far bin Muhammad as – Ash Shadiq
7. Imam Musa bin Ja’far as – Al Kadzim
8. Imam ‘Ali bin Musa as – Ar Ridha
9. Imam Muhammad bin ‘Ali as – Al Jawad At Taqi
10. Imam ‘Ali bin Muhammad as – Al Hadi At Taqi
11. Imam Hasan bin ‘Ali as – Az Zaki Al Askari
12. Imam Muhammad bin Hasan as – Al Mahdi Al Qoim Al hujjah Al Muntadzar Sohib Al Zaman Hujjatullah.

Dengan demikian jika berpegang pada pandangan Golongan Suni, maka Nabi Muhammad SAW tidak memenuhi Aspek ke-7 dari persamaan dengan Nabi Musa, karena Beliau SAW tidak mempunyai 12 Pemimpim/Imam yang berasal dari keturunannya Penggantinya (Wasiy).

Sedangkan menurut pandangan Golongan Syi’ah justru sebaliknya, bahwa Nabi Muhammad SAW telah memenuhi Aspek ke-7 dari persamaan dengan Nabi Musa, karena Beliau SAW mempunyai 12 Pemimpim/Imam yang berasal dari keturunannya Penggantinya (Wasiy), yaitu dari keturunan Ali bin Abi Thalib dan Fatimah Az-Zahra Binti Muhammad SAW.

Aspek-8: Penggantinya dan keturunannya di sucikan untuk menjadi Imam Universal.

Golongan Suni :
Sekalipun mengakui bahwa bahwa ayat pada QS. Al Ahzab [33]: 33 adalah berkenaan dengan penyucian, tetapi yang disucikan adalah anggota keluarga (Ahlul Bayt) Nabi Muhammad SAW, yang terdiri dari Nabi SAW sendiri, semua isteri Beliau, anaknya (Fatimah Az-Zahra), menantunya (Ali bin Abi Thalib) dan kedua cucunya (Hasan & Husein).

Dan penyucian tersebut se-mata2 bertujuan untuk menyucikan Ahlul Bayt Nabi SAW dari semua dosa, tidak ada tujuan lainnya.

Golongan Syi’ah :
Penyucian yang dimaksud pada QS. Al Ahzab [33]: 33 hanya berkena-an dengan anggota keluarga (Ahlul Bayt) Nabi Muhammad SAW, yang terdiri dari Nabi SAW sendiri, anaknya (Fatimah Az-Zahra), menantu-nya (Ali bin Abi Thalib) dan kedua cucunya (Hasan & Husein). Sedang-kan isteri2 Nabi SAW tidak termasuk didalamnya. Asbabun Nuzul ayat ini diperkuat dengan Hadist Al Kisa yang diakui oleh seluruh umat Islam sebagai Hadist Muttawatir.

Mengapa isteri2 Nabi SAW tidak termasuk didalam “Ahlul Bayt” yang disucikan ?

Pertama, karena penyucian ini adalah dalam rangka persiapan anggota keluarga Nabi SAW untuk menduduki jabatan Imam bagi seluruh Umat Manusia (lihat : penyucian Nabi Harun as dan anak-2nya yang akan menjabat kedudukan Imam Besar umat Israel pada Tanakh/Injil Perjanjian Lama Kitab Keluaran 40: 12-15)

Kedua, adalah aneh jika isteri2 Nabi SAW yang ada pada saat QS. Al Ahzab [33]: 33 diturunkan di sucikan, tetapi isteri Nabi SAW yang paling utama dan merupakan salah satu dari 4 wanita utama umat manusia, yaitu Khadijah Al Kubra tidak ikut di sucikan, karena telah jauh sebelumnya wafat.

Dengan demikian jika berpegang pada pandangan Golongan Suni, maka Nabi Muhammad SAW tidak memenuhi Aspek ke-8 persamaan dengan Nabi Musa, karena penyucian terhadap anggota keluarga Nabi SAW tidak ada kaitannya dengan pengangkatan Pemimpin/Imam

Sedangkan menurut pandangan Golongan Syi’ah justru sebaliknya, bahwa Nabi Muhammad SAW telah memenuhi Aspek ke-6 dari persamaan dengan Nabi Musa, karena penyucian anggota keluarga Nabi SAW adalah justru dalam rangka persiapan menjadi Imam bagi Penggantinya (Wasiy) yaitu Ali bin Abi Thalib beserta anak2nya.

Aspek-9: Kepemimpinan Penggantinya di khianati oleh sebagian umatnya

Golongan Suni :
Karena tidak mengakui pengangkatan Imam ‘Ali bin Abi Thalib sebagai Penerus/Pengganti Nabi Muhammad SAW dengan kedudukan Imam (pemimpin) bagi umat Islam, maka Golongan Suni berpandangan tidak ada perbuatan penghianatan terhadap kepemimpinan Penerus/-Pengganti Nabi Muhammad saw.

Pengangkatan Abu Bakar sebagai Khalifah setelah wafatnya Nabi Muhammad saw adalah sah menurut golongan sunni karena didasarkan pada kesepakatan (musyawarah) umat Islam yang dilaksanakan di Saqifah, Balai Pertemuan Bani Saidah.

Golongan Syi’ah:
Pengangkatan Ali bin Abi Thalib sebagai Imam (pemimpin) umat Islam (setelah Nabi SAW) oleh Nabi Muhammad SAW sendiri di Gadhir Khum adalah merupakan ketetapan Nabi SAW yang wajib di taati. Jika kemudian segelintir umat Islam yang berkumpul di Balai Pertemuan Saqifah Bani Saidah, memilih Abu Bakar sebagai Khalifah pertama setelah wafatnya Nabi SAW, maka perbuatan itu merupakan pembangkangan terhadap Ketetapan Nabi Muhammad SAW serta merupakan pengkhianatan terhadap Ali bin Abi Thalib yang telah diangkat sebagai Pemimpin/Imam Umat Islam. (Lihat Peristiwa Penolakan Bani Israel terhadap Pengangkatan Nabi Harun as sebagai Pengganti/Penerus Nabi Musa as pada Kemah Pertemuan Bani Korah, pada halam 32 s/d 36 )

Dengan demikian jika berpegang pada pandangan Golongan Suni, maka Nabi Muhammad SAW tidak memenuhi Aspek ke-9 persamaan dengan Nabi Musa as, karena tidak ada perbuatan penghianatan terhadap Pemimpin/Imam, sebab memang Beliau SAW tidak pernah mengangkat anggota keluarganya (Ali bin Abi Thalib as) sebagai Pemimpin/Imam umat Islam sepeninggal Nabi Muhammad SAW.

Sedangkan menurut pandangan Golongan Syi’ah justru sebaliknya, bahwa Nabi Muhammad SAW telah memenuhi Aspek ke-9 dari persamaan dengan Nabi Musa, karena pengangkatan Abu Bakar sebagai Khalifah pertama di Saqifah Bani Saidah jelas merupakan tindakan penghianatan terhadap Ali bin Abi Thalib yang telah diangkat oleh Nabi Muhammad SAW sebagai Pemimpin/Imam Umat Islam di Gadhir Khum pada tanggal 18 Dzulhijjah 10 H.

Perbedaan pandangan diantara Golongan Suni dan Golongan Syi’ah di atas, membawa implikasi terhadap pemenuhan kriteria Nabi Muhammad SAW sebagai Sang Mesiah Universal, khususnya dalam dalam kriteria “sama seperti Nabi Musa as” .

Apabila mengikuti pandangan Golongan Suni, maka tentunya akan sulit meyakinkan umat beragama lainnya tentang keabsahan Nabi Muhammad SAW sebagai Sang Mesiah Universal, karena pandangan Golongan Suni menafikan (menolak) adanya kesamaan antara Nabi Muhammad SAW dengan Nabi Musa as, khususnya berkaitan dengan Aspek Kenabian Ke-6 s/d Ke-9.
Sedangkan menurut pandangan Golongan Syi’ah, keseluruhan Aspek Kenabian (9 Aspek) pada Nabi Muhammad SAW adalah sesuai/sama seperti Nabi Musa as, sehingga menurut pandangan Golongan Syi’ah, tidak ada keraguan sedikitpun dan sepenuhnya dapat dibuktikan tentang keabsahan Nabi Muhammad SAW sebagai Sang Mesiah Universal.

Adanya dua pandangan yang berbeda di antara umat Islam tentang pemenuhan persyaratan kesamaan 9 aspek kenabian antara Nabi Muhammad SAW dengan Nabi Musa as sebagaimana di uraikan di atas, sesungguhnya tidak membawa konsekwensi apapun terhadap keabsahan Nabi Muhammad SAW sebagai Sang Mesiah Universal.

Sebagaimana dapat dimisalkan dengan 3 (tiga) orang buta yang berkumpul pada sebuah tanah lapang di siang hari. Ketiganya tidak bisa melihat matahari yang sedang bersinar terang. Tetapi ketidak mampuan mereka untuk melihat matahari, tidaklah berarti atau tidaklah mengakibatkan matahari tersebut menjadi tidak ada. Keberadaan Matahari tidak tergantung dari mampu atau tidak mampunya manusia melihatnya.

Demikian juga kebenaran dan keabsahan Nabi Muhammad SAW sebagai Sang Mesiah Universal tidaklah tergantung pada pandangan golongan-2 umat Islam yang menafikan adanya unsur2/faktor2 persyaratan sebagai Mesiah Universal pada diri Nabi Muhammad SAW, sekalipun mereka itu merupakan golongan yang mayoritas dari umat Islam.

Dalam kontek inilah hendaknya dipahami firman Allah SWT berikut ini :

Dan jika kamu menuruti kebanyakan orang-orang yang di muka bumi ini, niscaya mereka akan menyesatkanmu dari jalan Allah. Mereka tidak lain hanyalah mengikuti persangkaan belaka, dan mereka tidak lain hanyalah berdusta (terhadap Allah). (QS. Al An’am [6]: 116)

Hai orang-orang yang beriman, janganlah kamu mengambil jadi pemimpinmu, orang-orang yang membuat agamamu jadi buah ejekan dan permainan, (yaitu) di antara orang-orang yang telah diberi Kitab sebelummu, dan orang-orang yang kafir (orang-orang musyrik). Dan bertakwalah kepada Allah jika kamu betul-betul orang-orang yang beriman.(QS. Al Maidah [5]: 57)

Sekalipun pandangan Golongan Suni seperti yang diuraikan di atas mengakibat-kan sebahagian aspek kenabian Nabi Muhammad SAW menjadi “tidak seperti Nabi Musa as”, yaitu aspek ke-6 s/d ke-9, namun hal ini bukan berarti Golongan Suni tidak mempercayai/meyakini bahwasanya Nabi Muhammad SAW adalah “Pembawa Rahmat bagi Alam Semesta” yang bermakna juga sebagai Mesiah Universal. Hanya saja keyakinan tersebut se-mata2 di dasarkan pada Al Qur’an, tanpa didukung pembuktian yang terukur dengan alat ukur yang telah ditentukan berdasarkan Nubuat2 Mesianistik, sehingga keyakinan termaksud tidak dapat dijadikan hujjah (argumentasi) untuk menyakinkan umat non-Islam (yang tidak mempercayai Al Qur’an) tentang aspek kenabian Nabi Muhammad SAW yang “sama seperti Nabi Musa as”.

Dilain pihak, pandangan Golongan Suni yang berkaitan dengan Nubuat Mesianistik ini justru menguntungkan umat agama lainnya, terutama Umat agama Yahudi. Mengapa ?

Aqidah agama Yahudi sepenuhnya bertumpu pada harapan kedatangan Sang Mesiah Universal yang akan mengangkat derajat bangsa Israel pada tingkat yang paling tinggi di antara semua bangsa yang ada di dunia. Tanpa adanya harapan ini, maka umat Yahudi akan tercerai-berai mengikuti agama-agama lainnya.

Apabila ternyata Sang Mesiah Universal (yang di-tunggu2) sudah datang dan derajat Bangsa Israel tidak terangkat sampai puncak yang paling tinggi di antara umat manusia, maka tentunya kenyataan itu akan menghapuskan harapan umat Yahudi, dan pada gilirannya akan menghancurkan sendi2 ke-imanan mereka akan kebenaran agama Yahudi.

Oleh karena itu selama harapan umat Yahudi belum terwujud, maka mereka akan dan harus menolak semua klaim atas kemunculan Mesiah Universal yang tidak sejalan dengan harapan2 mereka.

Sebenarnya para pemimpin agama Yahudi (Rabi2) sejak awal kelahiran Nabi Muhammad SAW telah mengetahui bahwa Beliau SAW merupakan Mesiah Universal yang ditunggu2 dan dikhabarkan di dalam Nubuat2 Mesianistik pada Kitab2 Suci terdahulu. Hal inilah yang dikatakan di dalam Al Qur’an :

Orang-orang (Yahudi dan Nasrani) yang telah Kami beri Al Kitab (Taurat dan Injil) mengenal Muhammad seperti mereka mengenal anak-anaknya sendiri. Dan sesungguhnya sebahagian di antara mereka menyembunyikan kebenaran, padahal mereka mengetahui.(QS. Al Baqarah [2] : 146)

(Yaitu) orang-orang yang mengikut Rasul, Nabi yang ummi yang (namanya) mereka dapati tertulis di dalam Taurat dan Injil yang ada di sisi mereka, yang menyuruh mereka mengerjakan yang ma`ruf dan melarang mereka dari mengerjakan yang mungkar dan menghalalkan bagi mereka segala yang baik dan mengharamkan bagi mereka segala yang buruk dan membuang dari mereka beban-beban dan belenggu-belenggu yang ada pada mereka. Maka orang-orang yang beriman kepadanya, memuliakannya, menolongnya dan mengikuti cahaya yang terang yang diturunkan kepadanya (Al Qur’an), mereka itulah orang-orang yang beruntung.(QS. Al A’raf [7]: 157)

Keberadaan komunitas Yahudi di Semenanjung Arab (Madinah dan Khaibar) sebenarnya dilatar belakangi oleh pengetahuan mereka tentang kedatangan Mesiah Universal dari wilayah ini. Umat Yahudi memang me-nunggu2 kedatangan Sang Mesiah Universal tetapi bukan untuk mengikutinya, melainkan untuk menggagalkan baik kedatangan maupun misi Sang Mesiah Universal ini. Karena kedatangan Mesiah Universal dari tanah Arab yang bukan berasal dari keturunan Nabi Ishak as dan bukan pula dari garis keturunan Nabi Daud as (Suku Yehuda), akan membuka rahasia kepalsuan nubuat2 mesianistik yang mereka buat2 sendiri dan pada gilirannya akan memporak-porandakan sendi-2 aqidah dan keimanan agama Yahudi.

Sejarah Islam meriwayatkan hal-2 yang berkaitan dengan aktivitas umat Yahudi di Semenanjung Arab guna menggagalkan kedatangan dan misi Nabi Muhammad SAW sebagai Mesiah Universal, di antaranya :

1. Dimasa kanak2 nya Nabi Muhammad SAW diriwayatkan adanya peringatan tentang usaha pembunuhan atas Nabi Muhammad SAW oleh orang2 Yahudi ;

2. Selama Nabi Muhammad SAW berada di Madinah, sejak awal sampai akhir umat Yahudi baik secara terang2an maupun sembunyi2 (bekerja sama dengan kaum Musyrik Mekkah) senantiasa berupaya menggagalkan misi Nabi Muhammad SAW.

3. Setelah Nabi Muhammad SAW wafat, umat Yahudi tetap berupaya merusak agama Islam yang dibawa oleh Nabi Muhammad SAW dari dalam dengan cara membuat hadist2 palsu, yang dikenal sebagai “Hadist Israiliyat”, bekerjasama dengan beberapa unsur umat Islam (munafiqun).

Pandangan dikalangan mayoritas umat Islam sendiri yang secara langsung berakibat (se-olah2) aspek kenabian Nabi Muhammad SAW tidak sama seperti aspek kenabian Nabi Musa as, sangat sejalan dengan keinginan dan kepentingan umat Yahudi sejak awal, dengan demikian para pemimpin agama Yahudi dapat mengatakan kepada umatnya :

“Hai Bani Israel !!! Lihatlah mayoritas umat Islam sendiri tidak mengakui bahwa Nabi mereka “sama seperti Nabi Musa”, artinya Nabi mereka (Nabi Muhammad SAW) bukanlah Sang Mesiah Universal yang kita tunggu. Mesiah Universal dari keturunan Nabi Ishak dan Nabi Daud belum datang !”

Keselarasan antara pandangan Golongan Suni dengan keinginan/kepentingan umat Yahudi berkenaan dengan Ke-Mesiah-an Nabi Muhammad SAW, mungkin hanya kebetulan saja. Tetapi mungkin juga bukan hal yang kebetulan.

Bukankah Sejarah Islam juga meriwayatkan keberadaan figur Kaab Al-Akhbar, seorang ulama Yahudi yang kemudian masuk Islam dimasa pasca wafatnya Nabi Muhammad SAW ? Kedekatan Kaab Al-Akhbar dengan beberapa tokoh puncak umat Islam di masa itu, yaitu Khalifah Umar bin Khattab ra, Khalifah Utsman bin Affan ra , serta Abu Hurairah ra (perawi hadist terbanyak dilingkungan Golongan Suni) juga banyak diriwayatkan di dalam kitab2 sejarah Islam.

Melihat kenyataan bahwa pandangan Golongan Suni yang sejalan dan selaras dengan keinginan/kepentingan agama/kaum Yahudi, bukankah cukup alasan untuk berspekulasi, bahwa Kaab Al-Akhbar mungkin telah berhasil memasukan pemikirannya kedalam pandangan Golongan Suni melalui hadist2 Israiliyatnya, seperti hadist di bawah ini :

Dari Abu Hurairah r.a. berkata: “Dua orang bercaci maki, seorang dari kaum Muslim dan seorang dari Yahudi. Orang Muslim itu berkata: ……………………………………….., lalu Nabi SAW bersabda: “Janganlah kalian memilih aku atas Musa karena besok pada hari Qiyamat manusia pingsan dan akupun pingsan bersama mereka, Aku adalah orang yang mula pertama sadar, tiba-tiba Musa memegang pada satu segi Arasy, maka aku tidak tahu apakah ia termasuk orang yang pingsan dan sadar sebelum aku, atau ia termasuk orang yang dikecualikan Allah”.

Pada hadist yang diriwayat oleh Abu Hurairah ra (yang sangat erat hubungannya dengan Kaab Al Akhbar) di atas, menjelaskan bahwa Nabi Musa as dibangunkan Allah SWT lebih dahulu dahulu daripada Nabi Muhammad SAW di Hari Kiamat, halmana menunjukan bahwa kedudukan Nabi Musa as lebih utama dibandingkan dengan kedudukan Nabi Muhammad SAW.

———————————————————————————–

Memahami Kedudukan Nabi Muhammad SAW sebagai Mesiah Universal

Ketidakpahaman mayoritas umat Islam (Golongan Suni) terhadap kedudukan dan fungsi Nabi Muhammad SAW selaku Mesiah Universal/Juru Selamat Umat Manusia/Pembawa Rahmat bagi Alam Semesta, yang berpangkal pada penolakan persamaan aspek kenabian ke-6 s/d ke-6 antara Nabi Muhammad SAW dengan Nabi Musa as, kemudian mempengaruhi pandangan mayoritas umat Islam terhadap sosok dan kepribadian Nabi Muhammad SAW, yang pada akhirnya secara langsung mempengaruhi aqidah dan syariat ke-Islam-an mereka.

Sebagai konsekwensinya, maka selama mayoritas umat Islam belum mampu memahami kedudukkan dan fungsi Nabi Muhammad SAW sebagai Mesiah Universal, maka selama itu pula mayoritas umat Islam tidak akan mampu memahami ajaran agamanya secara utuh.

Sebagai Rahmatan lil Alamin, Nabi Muhammad SAW tidaklah sama seperti semua manusia lainnya yang pernah di ciptakan Allah SWT, Beliau SAW adalah se-mulia2-nya manusia yang pernah diciptakan oleh Allah SWT. Sehubungan dengan ini Allah SWT berfirman dalam Al Qur’an :

Sesungguhnya Allah dan malaikat-malaikat-Nya bershalawat untuk Nabi. Hai orang-orang yang beriman, bershalawatlah kamu untuk Nabi dan ucapkanlah salam penghormatan kepadanya.
QS. Al Ahzab [33]: 56

Tidak ada satupun manusia sejak Nabi Adam as sampai Hari Kiamat nanti yang memperoleh kehormatan dari Allah SWT sedemikian tingginya kecuali terhadap Nabi Muhammad SAW. Allah SWT memerintahkan umat manusia untuk mendirikan shalat, melaksanakan puasa, berzakat, beramal-soleh dan sebagainya, tetapi tentunya Allah SWT sendiri tidaklah melakukan/mengerjakan apa2 yang diperintahkanNya kepada umat manusia itu.

Namun berkenaan dengan Nabi Muhammad SAW, sebelum Allah SWT memerintahkan umat manusia untuk memberikan salam penghormatan (ber-shalawat) kepada Beliau SAW, Allah SWT sendiri beserta seluruh Malaikat telah terlebih dahulu dan terus senantiasa memberikan salam penghormatan (ber-shalawat) kepada Nabi Muhammad SAW.

Apakah Nabi SAW “maksum”?

Jikalau Para Imam Bani Israel dari keturunan Nabi Harun as dan para Imam dari ke-12 Suku Bani Israel saja disucikan oleh Allah SWT, yang artinya “maksum” yaitu setiap saat dicegah dari perbuatan melakukan kesalahan/dosa. Maka tentunya Nabi Muhammad SAW dan Para Imam Penerus (Wasiy) Beliau SAW yang berlingkup untuk seluruh umat manusia (Universal) lebih dapat dipastikan “ke-maksuman-nya”, sebagaimana telah ditetapkan oleh Allah SWT di dalam QS. Al Ahzab [33] : 33

Sementara ini kalangan mayoritas umat Islam mengakui bahwa Nabi Muhammad SAW hanya “maksum” pada saat menerima dan memberitakan wahyu Al Qur’an, sedangkan diluar itu Beliau SAW adalah seperti manusia biasa lainnya, yang dapat berbuat salah dan dosa. Sebagai akibat pemahaman ini sering kali terdengar ucapan di antara umat Islam: “Ah tidak apa2 koq berbuat salah, karena Nabi Muhammad SAW juga acapkali berbuat salah, Beliau kan hanya manusia biasa seperti kita”.

Jika benar Nabi Muhammad SAW bisa berbuat salah dan dosa (diluar saat menerima dan memberitakan wahyu Al Qur’an), maka bagaimana mungkin umat Islam diwajibkan berpegang pada Sunnah Beliau SAW? Bukankah dengan demikian di antara sunah2 Nabi SAW itu terbuka kemungkinan mencakup pula perkataan atau perbuatan Beliau SAW yang salah dan mengandung dosa? Dan jika Nabi Muhammad SAW adalah seperti manusia biasa yang bisa berbuat salah dan dosa, bagaimana mungkin Allah SWT justru memerintahkan seluruh umat manusia sampai Hari Kiamat untuk menjadikan Beliau SAW sebagai suri tauladan yang baik, sebagaimana firman Allah SWT :

Sesungguhnya telah ada pada (diri) Rasulullah itu suri teladan yang baik bagimu (yaitu) bagi orang yang mengharap (rahmat) Allah dan (kedatangan) hari kiamat dan dia banyak menyebut Allah.(QS. Al Ahzab [33] : 21)

Ucapan di atas sungguh2 merendahkan derajat dan kedudukan Nabi Muhammad SAW sebagai Rahmatan lil Alamin (Mesiah Universal), bagaimana mungkin kedudukan Nabi Muhammad SAW ditempatkan di bawah Para Imam Bani Israel yang dijamin Allah SWT tidak akan melakukan kesalahan/dosa karena mereka telah di sucikan (maksum).

Padahal dilain pihak mayoritas umat Islam mengakui adanya Hadist yang berbunyi: “Ulama2 dari umatku kedudukannya lebih tinggi dari nabi2 Bani Israel”. Para Imam Bani Israel itu kedudukannya lebih rendah dari nabi2 Bani Israel, dan Nabi Muhammad SAW ditempatkan dibawah para Imam Bani Israel, tetapi dilain pihak ulama2 umat Islam berada di atas nabi2 Bani Israel. Jadinya kedudukan Nabi Muhammad SAW berada jauh dibawah ulama2 umatnya sendiri ?

Cara berpikir mayoritas umat Islam yang kontradiktif di atas se-mata2 dikarenakan ketidakpahaman mereka terhadap kedudukan Nabi Muhammad SAW sebagai Mesiah Universal, Juru Selamat dan Pembawa Rahmat bagi seluruh umat Manusia. (Rahmatan lil Alamin)

Nabi SAW “bermuka masam”

Perendahan/pelecehan kedudukan Nabi Muhammad SAW oleh mayoritas umat Islam tidak saja terjadi pada tingkatan pembicaraan2 ringan se-hari2, melainkan lebih jauh lagi, yaitu dalam menafsirkan ayat2 Al Qur’an menisbahkan (melekatkan) hal2 yang tercela kepada Beliau SAW, seperti terjadi pada penafsiran yang umum atas Surat Abasa [80] : 1-2, yang merupakan Surat Makkiyah Ke-24 :

Dia (Muhammad) bermuka masam dan berpaling, karena telah datang seorang buta kepadanya,

Padahal pada Surat Al Qalam [68] : 4, yang merupakan Surat Makkiyah Ke-2, Allah SWT berfirman :

Dan sesungguhnya kamu benar-benar berbudi pekerti yang agung.

Bagaimana mungkin dapat dipahami oleh akal yang sehat bahwa Nabi Muhammad SAW yang Allah SWT sendiri telah mengatakan “berbudi pekerti yang agung”, malah bermuka masam dan berpaling ketika seorang pengikutnya yang saleh lagi buta menemuinya (Abdullah bin Ummi Maktum).
Disamping itu wahyu Al Qur’an itu diturunkan oleh Allah SWT kepada Nabi Muhammad SAW, halmana artinya komunikasi yang terjadi adalah antara Allah SAW (melalui Malaikat Jibril as) dan Nabi Muhammad SAW.

Dalam komunikasi dua pihak, maka tentunya kata ganti orang yang digunakan adalah kata ganti orang kedua (kamu, engkau dsb), bukan kata ganti orang ketiga (dia, mereka), karena kata orang ketiga mengandung arti yang bersangkutan tidak termasuk didalam komunikasi dua pihak.

Karena QS. Abasa [80]: 1 ditafsirkan : “Dia (Muhammad)….”, maka berarti Nabi Muhammad SAW merupakan orang ketiga yang tidak termasuk di dalam komunikasi antara Allah SWT dengan orang yang menerima wahyu Al Qur’an termaksud. Jadi kepada siapakah wahyu Surat Abasa ini diturunkan ? Atau berarti juga wahyu Al Qur’an ditafsirkan tidak saja turun kepada Nabi Muhammad SAW tetapi juga ada orang lain?

Nabi SAW “kena sihir”

Kalangan mayoritas umat Islam mempercayai bahwa di Madinah Nabi Muhammad SAW terkena sihir yang dilakukan orang orang Yahudi, sehingga selama 3 hari Beliau SAW menjadi “linglung”, berdasarkan hadist yang di riwayatkan oleh Ummul Mukminin Aisyah ra dan dimuat pada Kitab Sahih Bukhari.

Hadist ini jelas Dhaif (palsu), karena :

1. Jika benar Nabi SAW terkena sihir, maka benarlah tuduhkan kaum kaum musyrik yang mengatakan Nabi Muhammad SAW hanyalah seorang yang kena sihir, sebagaimana diberitakan dalam Al Qur’an :

Kami lebih mengetahui dalam keadaan bagaimana mereka mendengarkan sewaktu mereka mendengarkan kamu, dan sewaktu mereka berbisik-bisik (yaitu) ketika orang-orang zalim itu berkata: “Kamu tidak lain hanyalah mengikuti seorang laki-laki yang kena sihir”.(QS. Al Isra [17]: 47)

atau (mengapa tidak) diturunkan kepadanya perbendaharaan, atau (mengapa tidak) ada kebun baginya, yang dia dapat makan dari (hasil) nya?” Dan orang-orang yang zalim itu berkata: “Kamu sekalian tidak lain hanyalah mengikuti seorang lelaki yang kena sihir.”
(QS. Al Furqon [25]: 8)

2. Sihir adalah perbuatan syaitan, dan syaitan tidak bisa menggangu orang2 yang mukhlas, sedangkan Nabi Muhammad SAW pastilah lebih lagi dari sekedar orang yang mukhlas.

Dan mereka mengikuti apa yang dibaca oleh syaitan-syaitan pada masa kerajaan Sulaiman (dan mereka mengatakan bahwa Sulaiman itu mengerjakan sihir), padahal Sulaiman tidak kafir (tidak mengerjakan sihir), hanya syaitan-syaitan itulah yang kafir (mengerjakan sihir). Mereka mengajarkan sihir kepada manusia ……….(QS. Al Baqarah [2]: 102)

Iblis menjawab: “Demi kekuasaan Engkau aku akan menyesatkan mereka semuanya, kecuali hamba-hamba-Mu yang mukhlis di antara mereka.(QS. Shaad [38]: 82-83)

Hadist Dhaif tentang Nabi Muhammad SAW terkena sihir yang diriwayatkan oleh Aisyah ra (Kitab Sahih Bukhari) ini kemudian diperkuat lagi dengan hadist2 lainnya (seperti pada Kitab Hadist Al Baihaqi), yang meriwayatkan ketika Nabi SAW terkena sihir inilah Allah SWT menurunkan Surat Al Falaq dan Surat An Nas (Surat Al Mu’awwidzatain), padahal kedua surat tersebut turun di Mekkah sebagai Surat Makkiyah Ke-20 dan Ke-22, sedangkan menurut riwayat hadistnya Nabi SAW terkena sihir ketika di Madinah.

Ketiga contoh di atas tentang rendahnya pandangan dan penghargaan mayoritas Umat Islam terhadap Nabi Muhammad SAW, hanya sekedar mewakili dari banyak lagi contoh2 lainnya yang sejenis, dimana jika dijelaskan satu persatu, niscaya dapat disusun ke dalam sebuah buku tebal tersendiri.
Pandangan dan penghargaan mayoritas umat Islam terhadap Nabi Muhammad SAW sebagaimana digambarkan di atas jelas sekali bertentangan dengan kedudukan dan fungsi Beliau SAW sebagai Mesiah Universal/Juru Selamat dan Pembawa Rahmat bagi umat manusia serta seluruh alam semesta.

Dengan keadaan seperti ini bagaimana mungkin umat Islam mampu menyakinkan umat agama lainnya tentang kebenaran ajaran Agama Islam, karena syarat utama kebenaran ajaran agama samawi di akhir jaman adalah bahwa Nabi Pembawa Risalahnya haruslah memenuhi persyaratan sebagai Sang Mesiah Universal.

Dan sebaliknya, rendahnya penghargaan umat Islam terhadap Nabi Muhammad SAW, justru dapat dijadikan senjata oleh umat agama lainnya, dimana mereka akan mengatakan, “lihat ! umat Islam sendiri mengakui bahwa Nabi Muhammad SAW mempunyai banyak kelemahan seperti layaknya manusia biasa, jadi mana mungkin Nabi Muhammad SAW bisa di akui sebagai Sang Mesiah Universal”.

Kesimpulan/Penutup

1. Ditinjau dari aspek ajarannya, maka pada hakekatnya semua agama samawi mengandung ajaran yang sama, baik pada segi Tauhid maupun Aqidahnya, yang berbeda adalah pada segi syariatnya saja, karena disesuaikan dengan kondisi ruang dan waktunya.

Semua agama samawi mengajarkan bahwa Tuhan itu Esa, Tuhan itu adalah Maha Pencipta Alam Semesta berserta Isinya, sembahlah Tuhan Yang Esa jangan menduakanNya, berlombalah berbuat kebaikan dan janganlah berbuatan kejahatan. Perbedaannya hanyalah berkaitan dengan muatan materi ajarannya yang disesuaikan dengan kemampuan umat manusia pada kurun waktunya untuk memahami ajaran agama yang bersangkutan.

Mungkin tahapan perkembangan muatan materi ajaran agama2 samawi ini dapat di ibaratkan seperti pelajaran pada jenjang pendidikan formal yang ada.
Ajaran agama (pesan Ilahiyah) yang dibawakan oleh Nabi Nuh as sampai Nabi Saleh as (Kaum Tsamud), dapat di umpamakan seperti pelajaran bagi tingkat Taman Kanak2 dan Sekolah Dasar.

Ajaran agama yang dibawa oleh Nabi Ibrahim as sampai Nabi Yunus as, dapat di umpamakan seperti pelajaran bagi tingkat Sekolah Dasar. Kemudian ajaran agama yang dibawakan oleh Nabi Musa as sampai Nabi Zakaria as & Nabi Yahya as, dapat di umpamakan seperti pelajaran bagi tingkat Sekolah Lanjutan Pertama. Sedangkan ajaran agama yang dibawakan oleh Nabi Isa as diumpamakan seperti pelajaran bagi Sekolah Lanjutan Atas, dan sekaligus mempersiapkan Bani Israel untuk memasuki jenjang pendidikan di Perguruan Tinggi. Akhirnya, ajaran agama yang dibawakan oleh Nabi Muhammad SAW adalah untuk tingkatan pendidikan yang terakhir, yaitu tingkat Perguruan Tinggi sampai mencapai gelar akademis yang tertinggi, yaitu Tingkat S-3. Seluruh ajaran agama yang dibawa sejak Nabi Adam as sampai ke Nabi Muhammad SAW merupakan satu paket pelajaran pendidikan formal yang terpadu, selaras dan sejalan sesuai dengan tingkatannya, dan paket ajaran ini namanya “Islam”.

2. Agama-2 Samawi pada hakekatnya bertumpu pada dua aspek, yaitu aspek ajaran (aqidah dan syariat) dan aspek sosok/figur Pembawa Risalah Agama yang bersangkutan (Nabi/Rasul) berkaitan dengan kedudukan dan fungsi Juru Selamat/Pembawa Rahmat bagi Kaum tertentu atau bagi seluruh Umat Manusia (Mesiah Universal). Kedua aspek agama samawi ini merupakan satu kesatuan yang tidak bisa dipisahkan dalam rangka memperoleh pemahaman yang seutuhnya atas masing2 agama samawi yang bersangkutan.

Oleh karena itu ajaran Agama Yahudi tidaklah mungkin dapat dipahami secara utuh tanpa memahami kedudukan dan fungsi Nabi Musa as, Pembawa Risalah Agama Yahudi dengan Kitab Tauratnya (dan juga Nabi Daud as dengan Kitab Zaburnya) sebagai Juru Selamat Bani Israel (Mesiah Bani Israel).

Demikian juga, Agama Nasrani/Kristen tidaklah mungkin dapat dipahami secara utuh tanpa memahami kedudukan dan fungsi Nabi Isa as (Yesus), Pembawa Risalah Agama Nasrani dengan Kitab Injilnya, sebagai Nabi Terakhir/Penutup Bani Israel dan sekaligus Juru Selamat Bani Israel, yang dikirim oleh Allah SWT guna memberikan peringatan kepada Bani Israel atas penyelewengan2 yang telah mereka dilakukan dan sekaligus mempersiapkan Bani Israel untuk menyongsong kehadiran Sang Juru Selamat/Pembawa Rahmat bagi seluruh umat manusia (Sang Mesiah Universal).

Dan terlebih lagi tentunya dengan Agama Islam yang dibawa oleh Nabi Muhammad SAW bagi seluruh umat manusia. Ajaran Agama Islam mutlak hanya mungkin dipahami secara utuh dan benar dengan bertitik pangkal pada pemahaman tentang kedudukan dan fungsi Nabi Muhammad SAW sebagai Juru Selamat/Pembawa Rahmat bagi seluruh umat manusia dan alam semesta (Rahmatan lil Alamin), yaitu sebagai Sang Mesiah Universal.

3. Kehadiran Mesiah Universal yang dijanjikan menjadi “Thema Sentral” agama2 samawi, dimana hampir semua Nabi yang di utus oleh Allah SWT memberitakan tentang ciri2 dari Sang Mesiah Universal tersebut. Berita2 atau Riwayat2 tentang Mesiah yang terdapat pada Kitab2 Suci Agama Samawi disebut pula sebagai “Nubuat Mesianistik”.

Adapun ciri utama Sang Mesiah Universal menurut Nubuat Mesianistik yang diakui oleh semua agama samawi adalah:

1). Sang Mesiah Universal berasal dari keturunan anaknya Nabi Ibrahim as yang dikorbankan,

2). Sang Mesiah Universal itu memiliki kesamaan dalam aspek kenabian dengan Nabi Musa as.

4. Di dalam perkembangan sejarahnya agama2 samawi ternyata tidak dapat bebaskan dirinya dari pengaruh2 kepentingan umatnya untuk mengaku/-mengklaim bahwa masing2 agama merupakan satu2nya agama yang benar dan Nabi Pembawa Risalah Agamnya adalah Sang Mesiah Universal yang ditunggu oleh segenap penganut agama samawi.

Untuk memperkuat klaim tersebut tidak segan2 pula para pemuka agama samawi, dalam hal ini Agama Yahudi, merubah bagian2 tertentu dari Kitab Suci Taurat (Tanakh), agar ciri2 Sang Mesiah Universal sesuai dan sejalan dengan apa yang mereka kehendaki.

Akhirnya, dapat kiranya disimpulkan bahwa perbedaan agama yang ada diantara agama2 samawi adalah bersumber dari persoalan siapakah anak Nabi Ibrahim yang dikorban itu, Ismail-kah atau Ishak-kah dan persoalan Nabi siapakah yang memiliki kesamaan dalam aspek kenabiannya dengan Nabi Musa as.
Kedua persoalan yang nampaknya sangat simpel, tetapi tidak mampu diselesaikan oleh umat manusia.
Dan kedua persoalan ini semata-mata membuktikan betapa benarnya firman Allah SWT,

…………..Sekiranya Allah menghendaki, niscaya kamu dijadikan-Nya satu umat (saja), tetapi Allah hendak menguji kamu terhadap pemberian-Nya kepadamu, maka berlomba-lombalah berbuat kebajikan. Hanya kepada Allah-lah kembali kamu semuanya, lalu diberitahukan-Nya kepadamu apa yang telah kamu perselisihkan itu,(QS. Al Maidah [5]: 48)

Dari ayat QS. Al Maidah [5]: 48 di atas sebenarnya sangat terang dan jelas, dimana melalui ayat tersebut Allah SWT menyatakan sesungguhnya sangat mudah bagi Allah SWT untuk menjadikan umat manusia seluruhnya sepakat terhadap siapakah yang sebenarnya Mesiah Universal itu (‘pemberian-Nya”), tetapi Allah SWT justru menjadikan “pemberian-Nya kepadamu” yaitu Sang Mesiah Universal untuk seluruh umat manusia itu sebagai ujian bagi umat manusia apakah mampu mengenali dan mengimani Sang Mesiah Universal itu.

Tetapi pada akhirnya, ketika umat manusia kembali kepada Allah SWT, maka Dia akan memberitahukan siapakah yang sebenarnya Sang Mesiah Universal itu, yang selalu diperselisihkan oleh umat manusia.

Sebagaimana layaknya suatu ujian, maka pemberitahuan Allah SWT tentang siapakah sebenarnya Sang Mesiah Universal adalah juga merupakan jawaban yang berfungsi untuk menilai keberhasilan ujian termaksud.

Bilamana selama hidup di dunia ternyata seseorang telah mengenali dan mengimani Mesiah Universal yang salah, maka artinya yang bersangkutan tidak berhasil lulus dari ujian Allah SWT, dan sebagai akibatnya yang bersangkutan tidak akan memperoleh keselamatan dan keberkatan pada kehidupan di dunia dan di akherat.

Tetapi sebaliknya, jika selama hidup di dunia ternyata seseorang telah mengenali dan mengimani Mesiah Universal yang benar, maka artinya yang bersangkutan berhasil lulus dari ujian Allah SWT, dan sebagai ganjarannya yang bersangkutan akan memperoleh keselamatan dan keberkatan pada kehidupan di dunia dan di akherat

Orang nasrani kemudian menganggap Nabi Isa as sebagai juru selamatnya dan menganggap Nabi Muhammad Saw sbg mesiah dan Nabi palsu. Tapi setelah diselidiki Nabi Isa as tidak memiliki ciri kesamaan apapun dgn Nabi Musa as.

Bukankah di Al-Quran dikatakan bahwa nama Nabi Muhammad tertulis di alkitab? Coba anda cari ga bakalan ada, dan itulah senjata nasrani. Tapi setelah di cek dalam alkitab bahasa Ibrani, ternyata ditemukan, tapi bukan dgn nama “Ahmad” namun dgn tulisan “HMD” atau “Hamda” yang artinya adalah terpuji. Tapi “Hamda” juga bisa berarti “barang yang indah”, bah terjemahan kedualah yang diambil dan dijadikan patokan alkitab, namun itulah kelemahan kita karena tidak ada bukti lain.

Oleh ahli sejarah kemudian ditelusuri kembali, dan ditemukan bahwa ciri2 yang sama seperti musa as ternyata ada pada diri nabi muhammad saw. dan umat nasrani ga berkutik ketika disodorkan bukti terebut.

Ingat bung, bukti2 di atas lah yang disembunyikan oleh bangsa israil pada masa kenabian Nabi Muhammad Saw, karena bukti itulah mereka hendak membunuh Nabi Muhammad Saw.

Tentu anda tahu hadits 12 imam, 12 khalifah, Hadits kedudukan Imam ‘Ali dalam kitab2 sunni, sekarang saya tanya siapa saja 12 imam/khalifah versi sunni?

Apabila mengikuti pandangan Golongan Suni, maka tentunya akan sulit meyakinkan umat beragama lainnya tentang keabsahan Nabi Muhammad SAW sebagai Sang Mesiah Universal, karena pandangan Golongan Suni menafikan (menolak) adanya kesamaan antara Nabi Muhammad SAW dengan Nabi Musa as, khususnya berkaitan dengan Aspek Kenabian Ke-6 s/d Ke-9.

nih bukti2 hadits 12 imam dari kitab2 sunni yang ditolak oleh sunni sendiri :

Rasulullah saw bersabda, “Siapa yang ingin hidup seperti hidupku dan wafat seperti wafatku serta masuk ke surga yang telah dijanjikan kepadaku oleh Tuhanku yaitu Jannatul Khuld, maka hendaklah berwilayah kepada Ali dan keturunan sesudahnya, karena sesungguhnya mereka tidak akan mengeluarkan kamu dari pintu petunjuk dan tidak akan memasukkan kamu ke pintu kesesatan” (Referensi Sahih Ahlussunnah : Sahih Bukhari juz 5, Sahih Muslim juz 2; Adzahabi dalam kitabnya Mizanul I’tidal juz 4; Al-Khawarizmi dalam kitabnya Al-Manaqib, Al-Qunduzi Al-Hanafi dalam kitabnya Yanabi’ al-Mawaddah; Ibnu Hajar Asqalani as-Syafi’i dalam kitabnya Al-Ishabah juz 1)

Rasulullah saw bersabda, “Wahai manusia! Hormatilah Ali karena Allah telah mengkaruniakan kelebihan kepadanya. Terimalah Ali karena Allah telah melantiknya untuk kalian. Wahai manusia! Sesungguhnya Ali adalah imam dari Allah. Allah sekali-kali tidak akan menerima taubat seorang yang mengingkari wilayahnya. Dan Allah sekali-kali tidak akan mengampuninya. Sudah pasti Allah akan melakukan hal demikian ini terhadap orang yang menyalahi perintah-Nya mengenainya. Dan Dia akan menyiksanya dengan siksaan pedih yang berpanjangan. Lantaran itu kalian berhati-hatilah supaya kalian tidak menyalahinya. Justru itu kalian akan dibakar di neraka di mana bahan bakarnya adalah manusia dan batu disediakan kepada orang-orang yang ingkar” (Referensi Sahih Ahlussunnah : Al-Qunduzi al-Hanafi dalam kitabnya Yanabi` al-Mawaddah; al-Khawarizmi dalam kitabnya al-Manaqib; Ibnu Hajar dalam kitabnya Tahdhib al-Tahdhib juz 1)

Rasulullah saw bersabda, “Wahai manusia! Dengan akulah demi Allah, para Nabi dan Rasul yang terdahulu diberi khabar gembira. Aku adalah penutup para Nabi dan Rasul. Akulah hujjah atas semua makhluk di bumi dan di langit. Barangsiapa yang meragukan Ali adalah kafir sebagaimana kafir jahiliyah. Dan barangsiapa yang meragukan sabdaku ini, berarti dia meragukan seluruhnya. Orang yang meragukannya adalah neraka sebagai balasannya” (Referensi Sahih Ahlussunnah : Al-Qunduzi al-Hanafi dalam kitabnya Yanabi’ al-Mawaddah; al-Hakim dalam kitabnya al-Mustadrak juz 3)

Rasulullah saw bersabda, “Ali adalah pemimpin setiap orang yang beriman sesudahku” (Referensi Sahih Ahlussunnah : Sahih Tirmidzi, juz 5; Al-Qunduzi al-Hanafi dalam kitabnya Yanabi’ al-mawaddah; Al-Khawarizmi al-Hanafi dalam kitabnya Al-Manaqib; Ibnu Hajar dalam kitabnya Al-Ishabah juz 2; An-Nasa’i As-Syafi’i dalam kitabnya Khashaish Amirul Mukminin; Ibnu Asakir as-Syafi’i dalam kitabnya Tarjamah Ali bin Abi Thalib dalam Tarikh Damsyiq juz 1; Ibnu Atsir dalam kitabnya Jami’ al-Ushul juz 9)

Rasulullah saw bersabda, “Barangsiapa yang mati tanpa ketaatan (kepada seorang imam), mati sebagai murtad dan kafir.” (Referensi Sahih Ahlussunnah : Ahmad ibn Hanbal dalam kitabnya Musnad Ahmad, juz 3)

“Barangsiapa yang mati tanpa berbaiat (terhadap seorang imam), maka ia mati sebagai kafir.” (Referensi Sahih Ahlussunnah : Sahih Muslim)

“Barangsiapa mati dan tidak memiliki seorang imam, ia mati sebagai seorang kafir.” (Referensi Sahih Ahlussunnah : Al-Mu’jam al-Kabir juz 10)

“Selama masih ada paling sedikit dua orang (di dunia), persoalan ini (kekhalifahan) tetap berada di tangan Quraisy.” (Referensi Sahih Ahlussunnah : Sahih Muslim, Sahih Bukhari, Musnad Ahmad)

“Barangsiapa yang mati tanpa seorang imam, maka ia mati sebagai kafir.” (Referensi Sahih Ahlussunnah : Musnad Ahmad juz 4)

“Barangsiapa yang mati tidak memiliki imam umatnya, maka ia mati sebagai seorang kafir.” (Referensi Sahih Ahlussunnah : Al-Hakim dalam kitabnya Mustadrak juz 1)
Dari Ali mengatakan bahwa Rasulullah saw ketika menafsirkan ayat al-Qur’an, ‘(ingatlah) suatu hari ketika Kami memanggil setiap orang dengan imamnya’ (QS.Al-Isra:71) beliau bersabda, ‘Setiap kelompok akan dipanggil dengan imam zamannya.” (Referensi Sahih Ahlussunnah : Ad-Durr al-Mantsur juz 4; AL-Qurthubi dalam kitabnya Tafsir)

Jabir berkata, “Aku mendengar Rasulullah saw bersabda, ‘Akan ada 12 pemimpin dan khalifah.’ Kemudian beliau menambahkan sesuatu yang tidak bisa kudengar. Ayahku berkata bahwa Rasulullah saw bersabda, ‘Semuanya dari golongan Quraisy.’” (Referensi Sahih Ahlussunnah : Sahih Bukhari juz 4; Sahih Muslim; Sahih Tirmidzi; Sunan Abu Dawud; Musnad Ahmad)

Jabir meriwayatkan, “Aku dan ayahku pergi menemui Rasulullah saw. Kami mendengarnya bersabda, ‘Persoalan ini (kekhalifahan) tidak akan berakhir sampai datang 12 khalifah.’ Kemudian beliau menambahkan sesuatu yang tidak kudengar aku menanyakan pada ayahku apa yang Rasulullah saw sabdakan. Beliau saw bersabda, ‘Semuanya dari golongan Quraisy.’” (Referensi Sahih Ahlussunnah : Sahih Muslim)
Rasulullah saw bersabda, “Agama Islam akan tetap berdiri sampai 12 khalifah, yang semuanya dari golongan Quraisy, memerintah atas kamu.” (Referensi Sahih Ahlussunnah : Sahih Muslim; Syarah Nawawi)

Jabir berkata, “Rasulullah saw bersabda, ‘Akan ada 12 imam dan pemimpin setelahku.” Kemudian beliau mengatakan sesuatu yang tak dapat kumengerti. Aku menanyakan pada seseorang di sampingku tentang itu. Ia berkata, “Semuanya dari golongan Quraisy’” (Referensi Sahih Ahlussunnah : Sahih At-Tirmidzi juz 2)
Rasulullah saw bersabda, “Terdapat 12 khalifah untuk umat (Islam) ini.” (Referensi Sahih Ahlussunnah : Musnad Ahmad juz 5)

Rasulullah saw bersabda, “Agama ini akan tetap agung sampai datang 12 imam.” Mendengar hal ini, orang-orang mengagungkan Allah dengan berkata Allahu Akbar dan menangis keras. Kemudian beliau saw mengatakan sesuatu dengan suara yang pelan. “Aku bertanya pada ayahku, ‘Apa yang beliau katakan?’ ‘Mereka semua dari golongan Quraisy,’ jawabnya.’” (Referensi Sahih Ahlussunnah : Sahih Abu Dawud juz 2)

Awn mengutip ayahnya Abu Juhayfah sebagai berikut, “Aku dan pamanku sedang bersama Rasulullah saw, ketika itu beliau bersabda, “Urusan umatku akan terus berlalu sampai datang 12 khalifah.’ Kemudian beliau memelankan suaranya. Aku bertanya oleh Rasulullah saw. Ia menjawab, ‘Wahai anakku!’ Rasulullah saw bersabda bahwa mereka semua dari golongan Quraisy’” (Referensi Sahih Ahlussunnah : Mustadrak ‘ala ash-Shahihayn juz 3)

Masyruq berkata, “Kami duduk dengan Abdullah bin Mas’ud, mempelajari al-Qur’an darinya. Seseorang bertanya padanya, ‘Apakah engkau menanyakan kepada Rasulullah saw berapa khalifah yang akan memerintah umat ini?’ Ibnu Mas’ud menjawab, ‘Tentu saja kami menanyakan hal ini kepada Rasulullah saw dan beliau menjawab, ’12, seperti jumlah pemimpin suku Bani Israil.’” (Referensi Sahih Ahlussunnah : Musnad Ahmad juz 1)

Jabir meriwayatkan, “Aku dan ayahku sedang berhadapan dengan Rasulullah saw ketika beliau bersabda, ‘Pemerintahan dan khalifah umat islam ini akan berjumlah 12. mereka tidak akan menderita meskipun orang-orang tidak memberikan pertolongan.’ Dan menambahkan sesuatu yang tidak kudengar. Aku menanyakan pada ayahku tentang hal itu, ‘Rasulullah saw mengatakan bahwa mereka semua dari golongan Quraisy,’ jawabnya’” (Referensi Sahih Ahlussunnah : Al-Mu’jam Al-Kabir oleh Thabrani juz 2)

.
Dalil 12 Imam adalah Dari Bani Hasyim

Hadis-hadis tentang 12 imam adalah sahih dan mutawatir, mereka semua dari golongan Quraisy. Sekarang dari bani apakah mereka?

Jabir berkata, “Aku dan ayahku berada di hadapan Rasulullah saw ketika beliau bersabda, ‘Akan ada 12 khalifah setelahku.’ Kemudian beliau memelankan suaranya. Aku bertanya pada ayahku apa yang dikatakan oleh Rasulullah saw dengan pelan. Ia menjawab bahwa Rasulullah saw bersabda, ‘Mereka semua berasal dari Bani Hasyim!’” (Referensi Sahih Ahlussunnah : Al-Qunduzi Al-Hanafi dalam kitabnya Yanabi’ Al-Mawaddah, Maktabah Ibnu Taymiyah)

Siapakah 12 Imam Itu?

Siapakah mereka (Imam 12)? Keluarga suci (Ahlulbait) Nabi? Sahabat Nabi? Berikut ini adalah dalil-dalil Sahihnya dari kitab-kitab Ahlussunnah.

Dari Ibnu Abbas, “Rasulullah saw bersabda, ‘Barangsiapa ingin hidup dan mati sepertiku dan ditempatkan di surga ‘Adn yang diciptakan Allah, maka harus mengikuti Ali dan penerusnya dan para imam setelahku, karena mereka adalah Ahlulbaitku. Mereka diciptakan dari tanahku dan diberikan pengetahuan. Kesengsaraan bagi orang yang menolak derajat ketinggian mereka. Kesengsaraan bagi orang yang menolak hubungan mereka dengaku. Semoga Allah mencabutnya dari syafaat mereka’” (Referensi Sahih Ahlussunnah : Hilyat Al-Awliya juz 1)

Abu Sa’id al-Khudri berkata, “Rasulullah saw menyelesaikan shalat yang pertama bersama kami, kemudian membalik badan menghadap kami dan bersabda, ‘Wahai para sahabatku, Ahlulbaitku di sisimu adalahseperti perahu Nuh dan gerbang Tobat. Maka setelahku, berpegang teguhlah pada Ahlulbaiku, pengikut kebenaran dan keturunanku. Dan pasti kalian tidak akan tersesat’ beliau di tanya,’Wahai Rasulullah, ada berapa jumlah imam setelahmu?’ Beliau menjawab, ‘Mereka berjumlah 12 dari Ahlulbaitku’” (Referensi Sahih Ahlussunnah : HR. Al-Hakim dalam kitabnya Al-Mustadrak Ash-Shahihain, juz 2, Al-Hakim berkata hadits ini Sahih; Musnad al-Firdaus)

Seorang Yahudi memanggil Na’tsal untuk datang menemui Rasulullah saw dan berkata, “Wahai Muhammad! Aku memiliki beberapa pertanyaan yang telah lama kusimpan. Jika engkau dapat menjawabnya, maka aku akan mameluk Islam dengan pertolonganmu.” Rasulullah saw bersabda, “Wahai Abu Amarah! Engkau dapat menanyakannya padaku!” Ia bertanya, “Wahai Muhammad! Bertahukanlah kepadaku penerus-penerusmu, karena tidak ada Rasul tanpa penerus.” Rasulullah saw menjawab, “Penerusku adalah Ali bin Abi Thalib dan setelahnya adalah kedua cucuku Al-Hasan dan Al-Husain, yang setelahnya akan ada 9 imam dari keturunan al-Husain yang datang secara berurutan.” Kemudian Yahudi itu berkata, “Sebutkan nama-nama mereka, wahai Muhammad!” Rasulullah saw menyatakan, “Setelah al-Husain akan ada putranya Ali (Zainal Abidin), setelahnya Muhammad (Al-Baqir), setelahnya Ja’far (Ash-Shadiq), setelahnya Musa (Al-Kazhim), setelahnya Ali (Ar-Ridha), setelahnya Muhammad (Al-Jawad) setelahnya Ali (Al-Hadi), setelahnya Hasan (Al-Asykari) dan setelah Hasan putranya Hujjah Muhammad Al-Mahdi. Maka jumlah mereka ada 12 imam.” (Referensi Sahih Ahlussunnah : Al-Qunduzi al-Hanafi dalam kitabnya Yanabi’ al-Mawaddah)

PERLU DIGARIS BAWAHI SEMUA ITU ADALAH HADITS DARI KITAB-KITAB SUNNI, sampai dimana lagi kalian mau menolaknya?

Selamat menempuh ujian Allah SWT !!!

 

Kedudukan Hadis Umat Mengkhianati Ali Sepeninggal Nabi SAW

Rasulullah SAW telah mengabarkan kepada Imam Ali bahwa sepeninggal Beliau SAW, umat akan mengkhianati Imam Ali. Hal ini telah dinyatakan dalam hadis-hadis shahih. Salah satunya dalam hadis berikut

حدثنا أبو حفص عمر بن أحمد الجمحي بمكة ثنا علي بن عبد العزيز ثنا عمرو بن عون ثنا هشيم عن إسماعيل بن سالم عن أبي إدريس الأودي عن علي رضى الله تعالى عنه قال إن مما عهد إلي النبي صلى الله عليه وسلم أن الأمة ستغدر بي بعده

Telah menceritakan kepada kami Abu Hafsh Umar bin Ahmad Al Jumahi di Makkah yang berkata telah menceritakan kepada kami Ali bin Abdul Aziz yang berkata telah menceritakan kepada kami Amru bin ‘Aun yang berkata telah menceritakan kepada kami Husyaim dari Ismail bin Salim dari Abi Idris Al Awdi dari Ali Radhiyallahu ‘anhu yang berkata “Diantara yang dijanjikan Nabi SAW kepadaku bahwa Umat akan mengkhianatiku sepeninggal Beliau”. [Hadis riwayat Al Hakim dalam Al Mustadrak 3/150 no 4676 dishahihkan oleh Al Hakim dan Adz Dzahabi dalam At Talkhis]

Hadis ini adalah hadis yang shahih sebagaimana yang dikatakan oleh Al Hakim dan Adz Dzahabi. Selain itu hadis ini juga diriwayatkan oleh Ad Dulabi dalam Al Kuna Wal Asmaa’ 2/442 no 441

حدثنا يحيى بن غيلان ، عن أبي عوانة ، عن إسماعيل بن سالم ، وحدثنا فهد بن عوف ، قال ، ثنا أبو عوانة ، عن إسماعيل بن سالم ، عن أبي إدريس إبراهيم بن أبي حديد الأودي أن علي بن أبي طالب ، قال : عهد إلي النبي صلى الله عليه وسلم أن الأمة ستغدر بي من بعده

Telah menceritakan kepada kami Yahya bin Ghailan dari Abu ‘Awanah dari Ismail bin Salim dan telah menceritakan kepada kami Fahd bin Auf yang berkata telah menceritakan kepada kami Abu ‘Awanah dari Ismail bin Salim dari Abi Idris Ibrahim bin Abi Hadid Al Awdi bahwa Ali bin Abi Thalib berkata “telah dijanjikan oleh Nabi SAW bahwa Umat akan mengkhianatiku sepeninggal Beliau”.

Hadis ini sanadnya shahih dan diriwayatkan oleh para perawi yang terpercaya yaitu sanad Yahya bin Ghailan dari Abu Awanah dari Ismail bin Salim dari Ibrahim bin Abi Hadid dari Ali. Ibrahim adalah seorang tabiin yang melihat atau bertemu dengan Ali.

  • Yahya bin Ghailan dia adalah perawi Muslim Nasa’i dan Tirmidzi. Ibnu Hajar menyebutkan biografinya dalam At Tahdzib juz 11 no 429 dan ia telah dinyatakan tsiqat oleh Ibnu Sahl, Al Khatib, Ibnu Hibban, dan Ibnu Sa’ad. Ibnu Hajar dalam At Taqrib 2/312 menyatakan ia tsiqat.
  • Abu ‘Awanah dia adalah Wadhdhah bin Abdullah Al Yasykuri perawi Bukhari Muslim dan Ashabus Sunan. Ibnu Hajar menyebutkan biografinya dalam At Tahdzib juz 11 no 204 dan ia telah dinyatakan tsiqat oleh Abu Hatim, Abu Zar’ah, Ahmad, Ibnu Hibban, Ibnu Sa’ad dan Ibnu Abdil Bar. Dalam At Taqrib 2/283 ia dinyatakan tsiqat . Adz Dzahabi dalam Al Kasyf no 6049 juga mengatakan ia tsiqah.
  • Ismail bin Salim adalah perawi Bukhari dalam Adabul Mufrad, Muslim, Abu Dawud dan An Nasa’i. Ibnu Hajar dalam At Tahdzib juz 1 no 554 menyebutkan bahwa ia dinyatakan tsiqat oleh Ibnu Sa’ad, Ahmad, Abu Hatim, Abu Zar’ah, Daruquthni, Yaqub Al Fasawi, Abu Ali Al Hafiz dan Ibnu Hibban. Dalam At Taqrib 1/94 ia dinyatakan tsiqat.
  • Ibrahim bin Abi Hadid dia adalah seorang tabiin yang tsiqah. Ibnu Hibban memasukkannya dalam Ats Tsiqat juz 4 no 1613. Al Bukhari dalam Tarikh Al Kabir juz 1 no 908 menyebutkan keterangan tentangnya bahwa telah meriwayatkan darinya Ismail bin Salim tanpa menyebutkan jarh terhadapnya. Sehingga Ibrahim bin Abi Hadid adalah tabiin yang tsiqah dan Al Bukhari juga menyebutkan kalau ia bertemu atau melihat Ali bin Abi Thalib RA.

Jadi hadis riwayat Ad Dulabi dalam Al Kuna adalah hadis yang shahih. Sebelum mengakhiri tulisan ini kami akan membantah syubhat kalau Ibrahim bin Abi Hadid itu majhul dan hadisnya dari Ali mursal.

.

.

Syubhat Abu Hatim

Abu Hatim dalam Al Jarh Wat Ta’dil 2/96 menyebutkan kalau riwayat Ibrahim bin Abi Hadid dari Ali mursal dan ia seorang yang majhul. Pernyataan ini tertolak dengan dasar ulama-ulama lain mengenalnya seperti Ibnu Hibban, Al Bukhari dan Ibnu Ma’in. Dalam Tarikh Ibnu Ma’in no 1861 riwayat ad Dawri berkata

سمعت يحيى يقول أبو إدريس إبراهيم بن أبى حديد قلت ليحيى هو الذي يروى عنه إسماعيل بن سالم قال نعم

Aku mendengar Yahya mengatakan Abu Idris Ibrahim bin Abi Hadid. Aku bertanya kepada Yahya “diakah yang telah meriwayatkan darinya Ismail bin Salim”. Ia menjawab “ benar”.

Kemudian juga disebutkan dalam Tarikh Ibnu Ma’in no 2547 dari Ad Dawri

سمعت يحيى يقول أبو إدريس إبراهيم بن أبي حديد صاحب إسماعيل بن سالم

Aku mendengar Yahya mengatakan Abu Idris Ibrahim bin Abi Hadid sahabat Ismail bin Salim.

Pernyataan Abu Hatim bahwa riwayat Ibrahim bin Abi Hadid dari Ali mursal adalah pernyataan keliru dan itu didasari oleh ketidaktahuannya akan siapa Ibrahim bin Abi Hadid. Al Bukhari berkata dalam Tarikh Al Kabir juz 1 no 908

قال لي بن زرارة أخبرنا هشيم قال حدثنا إسماعيل بن سالم عن أبي إدريس نظرت إلى علي

Telah berkata kepadaku Ibnu Zurarah yang mengabarkan kepada kami Husyaim yang menceritakan kepada kami Ismail bin Salim bahwa Abu Idris melihat Ali.

Atsar ini shahih. Ibnu Zurarah adalah Syaikh(guru) Bukhari dan telah dinyatakan dalam At Taqrib 1/735 bahwa ia tsiqat dan Husyaim bin Basyir disebutkan dalam At Taqrib 2/269 kalau ia tsiqat tsabit. Sedangkan Ismail bin Salim telah disebutkan ketsiqahannya. Riwayat Bukhari ini sebaik-baik bukti yang membantah pernyataan Abu Hatim.

Selain diriwayatkan oleh Ibrahim bin Abi Hadid, hadis tersebut juga diriwayatkan oleh Tsa’labah bin Yazid Al Himmani. Hadis Tsa’labah diriwayatkan dalam Tarikh Dimasyq Ibnu Asakir 42/447, Musnad Al Bazzar 3/91, Dalail Nubuwwah Baihaqi 7/312 no 2759 dan Al Kamil Ibnu Ady 6/216. Berikut sanad hadis Tsa’labah bin Yazid yang terdapat dalam kitab Al Mathalib Al Aliyah Ibnu Hajar 11/205 no 4018

حدثنا الفضل هو أبو نعيم ثنا فطر بن خليفة أخبرني حبيب بن أبي ثابت قال سمعت ثعلبة بن يزيد قال سمعت عليا يقول والله إنه لعهد النبي الأمي صلى الله عليه وسلم

Telah menceritakan kepada kami Fadhl (dia Abu Nu’aim) yang berkata telah menceritakan kepada kami Fithr bin Khalifah yang berkata telah mengabarkan kepadaku Habib bin Abi Tsabit yang berkata aku mendengar Tsa’labah bin Yazid berkata aku mendengar Ali mengatakan Demi Allah, sesungguhnya Nabi yang ummi telah menjanjikan kepadaku.

Sanad ini adalah sanad yang shahih dan tidak diragukan keshahihannya, kecuali oleh mereka yang tidak senang dengan matan hadis tersebut.

  • Fadhl bin Dukain atau Abu Nu’aim adalah perawi Bukhari Muslim dan Ashabus Sunan yang dikenal tsiqah. Ibnu Hajar dalam At Tahdzib juz 8 no 505 menyebutkan bahwa ia dinyatakan tsiqat oleh Ahmad, Yaqub bin Syaibah, Ibnu Sa’ad, Ibnu Syahin Abu Hatim dan yang lainnya. Dalam At Taqrib 2/11 Ibnu Hajar menyatakan ia tsiqat.
  • Fithr bin Khalifah adalah perawi Bukhari dan Ashabus Sunan. Ibnu Hajar dalam At Tahdzib juz 8 no 550 menyebutkan bahwa ia dinyatakan tsiqat oleh Ahmad bin Hanbal, Yahya bin Sa’id, Ibnu Ma’in, Ibnu Sa’ad, Al Ajli, Nasa’i, dan Ibnu Hibban. Dalam At Taqrib 2/16 Ibnu Hajar menyatakan ia shaduq (jujur).
  • Habib bin Abi Tsabit adalah perawi Bukhari Muslim dan Ashabus Sunan. Ibnu Hajar dalam At Tahdzib juz 2 no 323 menyebutkan kalau ia dinyatakan tsiqat oleh Al Ajli, An Nasa’i, Abu Hatim, Ibnu Ma’in, Ibnu Hibban,  dan Ibnu Ady. Dalam At Taqrib 1/183 ia dinyatakan tsiqat.
  • Tsa’labah bin Yazid adalah seorang tabiin yang tsiqat. Ibnu Hajar dalam At Tahdzib juz 2 no 42 menyebutkan bahwa ia dinyatakan tsiqat oleh An Nasa’i dan Ibnu Hibban memasukkannya dalam Ats Tsiqat. Al Bukhari berkata bahwa hadis-hadisnya perlu diteliti lagi dan tidak diikuti. Pernyataan Bukhari tidaklah benar, hadis Tsa’labah bin Yazid ini ternyata diikuti oleh yang lainnya yaitu oleh Ibrahim bin Abi Hadid dan Hayyan Al Asdi, mereka semua meriwayatkan dari Ali RA.  Ibnu Ady mengakui kalau Tsa’labah tidak memiliki hadis-hadis mungkar. Ibnu Hajar dalam At Taqrib 1/149 menyatakan ia seorang syiah yang shaduq.

Sekali lagi kami katakan hadis ini shahih dan tidak ada gunanya syubhat yang dilontarkan oleh sebagian orang. Diantara mereka, ada yang berhujjah dengan pernyataan Al Bukhari dalam Tarikh Al Kabir juz 2 no 2103 biografi Tsa’labah bin Yazid dimana Bukhari berkata “perlu diteliti lagi” kemudian Al Bukhari membawakan hadis Tsa’labah ini dan berkata “tidak diikuti”. Kami sudah katakan bahwa Al Bukhari tidaklah benar, hadis ini diikuti oleh yang lain yaitu Ibrahim bin Abi Hadid dan Hayyan Al Asdi.

Ibnu Hibban ternyata memuat biografi Tsa’labah bin Yazid dalam Al Majruhin no 170 dan mengatakan bahwa ia berlebihan dalam tasyayyu’ tidak bisa dijadikan hujjah jika menyendiri meriwayatkan dari Ali. Kami katakan pencacatan karena tasyayyu’ tidaklah diterima dan Ibnu Hibban sendiri memasukkan Tsa’labah bin Yazid sebagai perawi tsiqah dalam Ats Tsiqat juz 4 no 1995 ditambah lagi Tsa’labah tidak menyendiri meriwayatkan hadis ini.

Semua syubhat tersebut sangat lemah dan telah dijelaskan kekeliruannya tetapi mereka salafiyun tetap tidak rela kalau hadis ini dikatakan shahih. Padahal jika diteliti dengan standar ilmu hadis yang benar maka tidak diragukan lagi bahwa hadis ini bersanad shahih. Wallahu’alam

 

Setelah kaum muslimin menyalati jenazah Nabi saw., Imam Ali as. menggali kuburan untuknya. Setelah itu, ia menguburkan jenazah sau-daranya itu.Kekuatan Ali telah melemah. Ia berdiri di pinggiran kubur sembari menutupi kuburan itu dengan tanah dengan disertai linangan air mata. Ia mengeluh: “Sesungguhnya sabar itu indah, kecuali terhadapmu. Sesung-guhnya berkeluh-kesah itu buruk, kecuali atas dirimu. Sesungguhnya musibah atasmu sangat besar. Dan sesungguhnya sebelum dan sesudah-mu terdapat peristiwa besar.”[1] 

Pada hari bersejarah itu, bendera keadilan telah terlipat di alam kesedihan, tonggak-tonggak kebenaran telah roboh, dan cahaya yang telah menyinari alam telah lenyap. Beliaulah yang telah berhasil meng-ubah perjalanan hidup umat manusia dari kezaliman yang gelap gulita kepada kehidupan sejahtera yang penuh dengan peradAbân dan keadilan. Dalam kehidupan ini, suara para tiran musnah dan jeritan orang-orang jelata mendapat perhatian. Seluruh karunia Allah terhampar luas untuk hamba-hamba-Nya dan tak seorang pun memiliki kesempatan untuk menimbun harta untuk kepentingannya sendiri.

Muktamar Tsaqîfah

Dalam sejarah dunia Islam, muslimin tidak pernah menghadapi tragedi yang sangat berat sebagai cobaan dalam kehidupan mereka seberat peris-tiwa Tsaqîfah yang telah menyulut api fitnah di antara mereka sekaligus membuka pintu kehancuran bagi kehidupan mereka.

Kaum Anshar telah melangsungkan muktamar di Tsaqîfah Bani Sâ‘idah pada hari Nabi saw. wafat. Muktamar itu dihadiri oleh dua kubu, suku Aus dan Khazraj. Mereka berusaha mengatur siasat supaya kekha-lifahan tidak keluar dari kalangan mereka. Mereka tidak ingin muktamar tersebut diikuti oleh kaum Muhajirin yang secara terus terang telah menolak untuk membaiat Imam Ali as. yang telah dikukuhkan oleh Nabi saw. sebagai khalifah dan pemimpin umat pada peristiwa Ghadir Khum. Mereka tidak ingin bila kenabian dan kekhalifahan berkumpul di satu rumah, sebagaimana sebagian pembesar mereka juga pernah menentang Nabi saw. untuk menulis wasiat berkenaan dengan hak Ali as. Ketika itu mereka melontarkan tuduhan bahwa Nabi saw. sedang mengigau sehing-ga mereka pun berhasil melakukan makar tersebut.

Ala kulli hal, kaum Anshar telah berperan sebagai tulang punggung bagi kekuatan bersenjata pasukan Nabi saw. dan mereka pernah mene-barkan kesedihan dan duka di rumah-rumah kaum Quraisy yang kala itu hendak melakukan perlawanan terhadap Rasulullah saw. Ketika itu orang-orang Quraisy betul-betul merasa dengki terhadap kaum Anshar. Oleh karena itu, kaum Anshar segera mengadakan muktamar, karena khawatir terhadap kaum Muhajirin.

Hubâb bin Munzdir berkata: “Kami betul-betul merasa khawatir bila kalian diperintah oleh orang-orang yang anak-anak, nenek moyang, dan saudara-saudara mereka telah kita bunuh.”[2]

Kekhawatiran Hubbâb itu ternyata menjadi kenyataan. Setelah usia pemerintahan para khalifah usai, dinasti Bani kaum Umayyah berkuasa. Mereka berusaha merendahkan dan menghinakan para khalifah itu. Mu‘âwiyah telah berbuat zalim dan kejam. Ketika Yazîd bin Mu‘âwiyah memerintah, dia juga bertindak sewenang-wenang dan menghancurkan kehormatan mereka dengan berbagai macam siksa dan kejahatan. Yazîd menghalalkan harta, darah, dan kehormatan mereka pada tragedi Harrah. Sejarah tidak pernah menyaksikan kekejian dan kekezaman semacam itu.

Ala kulli hal, pada muktamar Tsaqîfah tersebut, kaum Anshar men-calonkan Sa‘d sebagai khalifah, kecuali Khudhair bin Usaid, pemimpin suku Aus. Ia enggan berbaiat kepada Sa‘d karena kedengkian yang telah tertanam antara sukunya dan suku Sa‘d, Khazraj. Sudah sejak lama memang hubungan antara kedua suku ini tegang.

‘Uwaim bin Sâ‘idah bangkit bersama Ma‘n bin ‘Adî, sekutu Anshar, untuk menjumpai Abu Bakar dan Umar. Mereka ingin memberitahukan kepada dua sahabat ini peristiwa yang sedang berlangsung di Tsaqîfah. Abu Bakar dan Umar terkejut. Mereka segera pergi menuju ke Tsaqîfah secara tiba-tiba. Musnahlah seluruh cita-cita yang telah dirajut oleh kaum Anshar. Wajah Sa‘d berubah. Setelah terjadi pertikaian yang tajam antara Abu Bakar dan kaum Anshar, kelompok Abu Bakar segera bangkit untuk membaiatnya. Umar yang bertindak sebagai pahlawan dalam baiat itu telah memainkan peranannya yang aktif di ajang perebutan kekuasaan itu. Dia menggiring masyarakat untuk membaiat sahabatnya, Abu Bakar. Abu Bakar keluar dari Tsaqîfah diikuti oleh para pendukungnya menuju ke masjid Nabi saw. dengan diiringi oleh teriakan suara takbir dan tahlil. Dalam baiat ini, pendapat keluarga Nabi saw. tidak dihiraukan. Begitu pula pendapat para pemuka sahabatnya, seperti Ammâr bin Yâsir, Abu Dzar, Miqdâd, dan sahabat-sahabat yang lain.

Sikap Imam Ali as. Terhadap Pembaiatan Abu Bakar

Para sejarawan dan perawi hadis sepakat bahwa Imam Ali as. menolak dan tidak menerima pembaiatan atas Abu Bakar. Ia lebih berhak untuk menjadi khalifah. Karena beliaulah orang yang paling dekat dengan Nabi saw. Kedudukan Ali as. di sisi Nabi saw. seperti kedudukan Hârûn di sisi Mûsâ as. Islam telah tegak karena perjuangan dan keberaniannya. Dia mengalami berbagai macam bencana dalam menegakkan Islam. Nabi saw. menjadikan Ali as. sebagai saudaranya. Ia pernah bersabda kepada kaum muslimin: “Barang siapa yang aku adalah pemimpinnya, maka Ali adalah juga pemimpinnya.”

Atas dasar ini, Ali as. menolak untuk membaiat Abu Bakar. Abu Bakar dan Umar telah bersepakat untuk menyeret Ali as. dan memak-sanya berbaiat. Umar bin Khaththab bersama sekelompok pengikutnya mengepung rumah Ali as. Dia menakut-nakuti, mengancam, dan meng-gertak Ali as. dengan menggenggam api untuk membakar rumah wahyu itu. Buah hati Nabi saw. dan penghulu para wanita semesta alam keluar dan bertanya dengan suara lantang: “Hai anak Khaththab, apa yang kamu bawa itu?” Umar menjawab dengan keras: “Yang aku bawa ini lebih hebat daripada yang telah dibawa oleh ayahmu.”[3]

Sangat disayangkan dan menggoncang kalbu setiap orang muslim! Mereka telah berani bertindak keras seperti itu terhadap Fatimah Az-Zahrâ’ as., buah hati Nabi saw. Padahal Allah ridha karena keridhaan Az-Zahrâ’ dan murka karena kemurkaannya. Melihat kelancangan ini, tidak ada yang layak kita ucapkan selain innâ lillâh wa innâ ilaihi râji‘ûn.

Akhirnya, mereka memaksa Imam Ali as. keluar dari rumahnya dengan paksa. Dengan pedang terhunus para pendukung Khalifah Abu Bakar menyeret Imam Ali as. untuk menghadap. Mereka berkata dengan lantang: “Baiatlah Abu Bakar! Baiatlah Abu Bakar!”

Imam Ali as. membela diri dengan hujah yang kokoh tanpa rasa takut sedikit pun terhadap kekerasan dan kekuatan mereka. Ia berkata: “Aku lebih berhak atas perkara ini daripada kalian. Aku tidak akan membaiat kalian, sebaliknya kalianlah yang semestinya membaiatku. Kalian telah merampas hak ini dari kaum Anshar dengan alasan bahwa kalian memiliki hubungan kekerabatan dengan Nabi saw. Tetapi kalian juga telah merampas kekhalifahan itu dari kami Ahlul Bait secara paksa. Bukankah kalian telah mendakwa di hadapan kaum Anshar bahwa kalian lebih berhak atas kekhilafahan ini daripada mereka dengan dalih Nabi Muhammad saw. berasal dari kalangan kalian, sehingga mereka rela memberikan dan menyerahkan kepemimpinan itu kepadamu? Kini aku juga ingin berdalih kepadamu seperti kamu berdalih kepada kaum Anshar. Sesungguhnya aku adalah orang yang lebih utama dan lebih dekat dengan Nabi saw., baik ketika ia masih hidup maupun setelah wafat. Camkanlah ucapanku ini, jika kamu beriman! Jika tidak, maka kamu telah berbuat zalim sedang kamu menyadarinya.”

Betapa indah hujah dan dalil tersebut. Kaum Muhajirin dapat mengalahkan kaum Anshar lantaran hujah itu, karena mereka merasa memiliki hubungan kekerabatan yang sangat dekat dengan Nabi saw. Argumentasi Imam Ali as. lebih kuat, lantaran suku Quraisy yang terdiri dari banyak kabilah dan memiliki hubungan kekeluargaan dengan Nabi saw. itu bukan sepupu-sepupu atau pamannya. Sementara hubungan kekerabatan antara Nabi saw. dengan Imam Ali as. terjalin dalam bentuk yang paling sempurna. Ali as. adalah sepupu Nabi saw., ayah dua orang cucunya, dan suami untuk putri semata wayangnya.

Walau demikian, Umar tetap memaksa Imam Ali as. dan berkata: “Berbaiatlah!”

“Jika aku tidak melakukannya?”, tanya Imam Ali pendek.

“Demi Allah yang tiada tuhan selain Dia, jika engkau tidak mem-baiat, aku akan penggal lehermu”, jawab Umar sengit.

Imam Ali as. diam sejenak. Ia memandang ke arah kaum yang telah disesatkan oleh hawa nafsu dan dibutakan oleh cinta kekuasaan itu. Imam Ali as. melihat tidak ada orang yang akan menolong dan membe-lanya dari kejahatan mereka. Akhirnya ia menjawab dengan nada sedih: “Jika demikian, kamu telah membunuh hamba Allah dan saudara Rasu-lullah.”

Umar segera menimpali dengan berang: “Membunuh hamba Allah, ya. Tetapi saudara Rasulullah, tidak.”

Umar telah lupa dengan sabda Nabi saw. bahwa Imam Ali as. adalah saudaranya, pintu kota ilmunya, dan kedudukannya di sisinya adalah sama dengan kedudukan Hârûn di sisi Mûsâ as. Ali as. adalah pejuang pertama Islam. Semua realita dan keutamaan itu telah dilupakan dan diingkari oleh Umar.

Kemudian Umar menoleh ke arah Abu Bakar seraya menyuruhnya untuk mengingkari hal itu. Kepada Abu Bakar, Umar berkata: “Mengapa engkau tidak menggunakan kekuasaanmu untuk memaksanya?”

Abu Bakar takut fitnah dan hal-hal yang tidak diinginkan terjadi. Akhirnya dia menentukan sikap: “Aku tidak akan memaksanya, selama Fatimah berada di sisinya.”

Akhirnya mereka membebaskan Imam Ali as. Ia berlari menuju ke makam saudaranya, Nabi saw., untuk mengadukan cobaan dan aral yang sedang menimpanya. Ia menangis tersedu-sedu seraya berkata: “Wahai putra ibuku, sesungguhnya kaum ini telah meremehkanku dan hampir saja mereka membunuhku.”[4]

Mereka telah meremehkan Imam Ali as. dan mengingkari wasiat-wasiat Nabi saw. berkenaan dengan dirinya. Setelah itu ia kembali ke rumah dengan hati yang hancur luluh dan sedih. Benar, telah terjadi apa yang telah diberitakan oleh Allah swt. akan terjadi pada umat Islam setelah Rasulullah saw. wafat. Mereka kembali kepada kekufuran. Allah swt. berfirman:

Muhammad itu tidak lain hanyalah seorang rasul; sungguh telah berlalu sebelumnya beberapa orang rasul. Apakah jika ia wafat atau dibunuh, kamu berbalik ke belakang (murtad)? Barang siapa yang berbalik ke belakang, maka ia tidak dapat mendatangkan mudarat kepada Allah sedikit pun ….”(QS. Âli ‘Imrân [3]:144)

Sungguh mereka telah kembali kepada kekufuran, kekufuran yang dapat menghancurkan iman dan harapan-harapan mereka. Innâ lillâh wa innâ ilaihi râji‘ûn.

Kita tutup lembaran peristiwa-peristiwa yang mengenaskan dan segala kebijakan pemerintah Abu Bakar yang tiran terhadap keluarga Nabi saw. ini, seperti merampas tanah Fadak, menghapus khumus, dan kebijakan-kebijakan yang lain. Seluruh peristiwa ini telah kami jelaskan secara rinci dalam Mawsû‘ah Al-Imam Amiril Mukminin as.

Fatimah Az-Zahrâ’ Menuju ke Alam Baka

Salah satu peristiwa yang sangat menyedihkan Imam Ali as. adalah kepergian buah hati Rasulullah saw., Fatimah Az-Zahrâ’ as. Ia jatuh sakit, sementara hatinya yang lembut tengah merasakan kesedihan yang mendalam. Rasa sakit telah menyerangnya. Dan kematian begitu cepat menghampirinya, sementara usianya masih begitu muda. Oh, betapa beratnya duka yang menimpa buah hati dan putri semata wayang Nabisaw. itu. Ia telah mengalami berbagai kekejaman dan kezaliman dalam masa yang sangat singkat setelah ayahandanya wafat. Mereka telah mengingkari kedudukannya yang mulia di sisi Rasulullah, merampas hak warisannya dan menyerang rumahnya.

Fatimah Az-Zahrâ’ telah menyampaikan wasiat terakhir yang maha penting kepada putra pamannya. Dalam wasiat itu ditegaskan agar orang-orang yang telah ikut serta merampas haknya tidak boleh menghadiri pemakaman, jenazahnya dikuburkan pada malam hari yang gelap gulita, dan kuburannya disembunyikan agar menjadi bukti betapa ia murka kepada mereka.

Imam Ali as. melaksanakan wasiat istrinya yang setia itu di pusara-nya yang terakhir. Ia berdiri di pinggir makamnya sambil menyiramnya dengan tetesan-tetesan air mata. Ia menyampaikan ucapan takziah, bela sungkawa dan pengaduan kepada Nabi saw. setelah menyampaikan salam kepada beliau:

Salam sejahtera untukmu dariku, ya Rasulullah, dan dari putrimu yang telah tiba di haribaanmu dan yang begitu cepatnya menyusulmu. Ya Rasulullah, betapa sedikitnya kesabaranku dengan kemangkatanmu dan betapa beratnya hati ini. Hanya saja, dalam perpisahan denganmu dan besarnya musibahmu ada tempat untuk berduka. Aku telah membaring-kanmu di liang kuburmu. Dan jiwamu telah pergi meninggalkanku ketika kepalamu berada di antara leher dan dadaku. Innâ lillâh wa innâ ilaihi râji‘ûn. Titipan telah dikembalikan dan gadai pun telah diambil kembali. Tetapi kesedihanku tetap abadi. Malam-malamkupun menjadi panjang, hingga Allah memilihkan untukku tempatmu yang kini engkau singgahi. Putrimu akan bercerita kepadamu tentang persekong-kolan umatmu untuk berbuat kejahatan. Tanyakanlah dan mintalah berita mengenai keadan mereka! Padahal perjanjian itu masih hangat dan namamu masih disebut-sebut. Salam sejahtera atasmu berdua, salam selamat tinggal, tanpa lalai dan jenuh! Jika aku berpaling, itu bukan karena bosan. Jika aku diam, itu bukan karena aku berburuk sangka terhadap apa yang dijanjikan Allah kepada orang-orang yang sabar.[5]

Ungkapan-ungkapan Imam Ali as. di atas menunjukkan betapa ia menga-lami kesedihan yang mendalam atas kepergian titipan Rasulullah saw. itu. Ungkapan-ungkapan itu juga menunjukkan betapa dalamnya sakit hati dan duka yang dialaminya akibat perlakuan umat Islam. Imam Ali as. juga minta kepada Nabi saw. agar memaksa putrinya bercerita dan memberi-kan keterangan tentang seluruh kejahatan dan kezaliman yang telah dilakukan oleh umatnya itu.

Seusai menguburkan jenazah buah hati Nabi saw., Imam Ali as. kembali ke rumah dengan rasa duka dan kesedihan yang datang silih berganti. Para sahabat telah mengasingkannya. Imam Ali as. berpaling sebagaimana mereka juga berpaling darinya. Ia bertekad untuk menjauhi seluruh urusan politik dan tidak terlibat di dalamnya.


1.Nahjul Balaghah, khotbah ke-409.

2.Hayâh Al-Imam Husain as., Jil. 1/ 235.

3.Ansâb Al-Asyrâf, karya Al-Balâdzurî. Para sejarahwan sepakat tentang adanya ancaman Umar terhadap Ali as. untuk membakar rumahnya itu. Silakan merujuk Târîkh Ath-Thabarî, Jil. 3/202, Târikh Abi Al-Fidâ’, Jil. 1/156, Târîkh Al-Ya‘qûbî, Jil. 2/105, Murûj Adz-Dzahab, Jil. 1/414, Al-Imâmah wa As-Siyâsah, Jil. 1/12, Syarah Nahjul Balâghah, karya Ibn Abil Hadîd, Jil. 1/ 34, Al-Amwâl, karya Abu ‘Ubaidah, hal. 131, A‘lâm An-Nisâ’, Jil. 3/205, danAl-Imam Ali, karya Abul Fattâh Maqshûd, Jil. 1/213.

4.Al-Imâmah wa As-Siyâsah, hal. 28-31.

5.Nahjul Balâghah, Jil. 2/ 182.

.

Penjagaan Nabi SAW dan Imam Ali AS atas keberlanjutan AGAMA iSLAM adalah lebih penting daripada beliau menjaga para sahabat nya. Lagipula proyek pengkaderan telah menghasilkan tokoh tokoh revolusioner yang tangguh seperti Salman Al Farisi, Abu Dzar Al Ghifari, Ammar bin Yasir, Miqdad dll

.

Imam Ali as. menerangkan kepada kita sebab mengapa beliau pada akhirnya memberikan baiat untuk Abu Bakar dan tidak terus mengambil sikap oposisi, apalagi perlawanan bersenjata!

.
Dalam keterangan-keterangan yang dinukil dari Imam Ali as. ada beberapa sebab:
Pertama, tidak adanya pembela yang cukup untuk mengambil alih kembali hak kewalian beliau.
Sikap Imam Ali as. itu telah beliau abadikan dalam benyak kesempatan, di antara dalam pidato beliau yang terkenal dengan nama khuthbah Syiqsyiqiyyah
.
Imam Ali as. berpidato:
أَمَا وَاللهِ لَقَدْ تَقَمَّصَهَا إبْنُ اَبِيْ قُحَافَةَ وَإِنَّهُ لَيَعْلَمُ أَنَّ مَحَلِّي مِنْهَا مَحَلُّ اْلقُطْبِ مِنَ الْرُحَى , يَنْحَدِرُ عَنِّي اْلسَيْلُ وَ لاَ يَرْقَى إلَىَّ الْطَيْرُ. فَسَدَلْتُ دُوْنَهَا ثَوْبًا  وَ طَوَيْتُ عَنْهَا كَشْحًا . وَ طَفِقْتُ أَرْتَئِ بَيْنَ أنْ أَصُوْلَ بِيَدٍ جَذَّاءَ أوْ أَصْبِرَ عَلَى طِخْيةٍ عَمْيَاءَ , يَهْرَمُ فِيْهَا الْكَبِيْرُ وَ يَشِيْبُ فِيْهَا الْصَغِيْرُ, وَ يَكْدَحُ  فِيْهَا الْمُؤْمِنُ حَتَّى يَلْقَى رَبَّهُ !
فَرَاَيْتُ اَنَّ الْصَبْرَ عَلَى هَاتَا أَحْجَى . فَصَبَرْتُ , وَ فِي الْعَيْنِ قَذًى, و فِي الْحَلْقِ شَجًا أَرَى تُرَاثِيْ نَهْبًا.                                                           
“Demi Allah, sesungguhnya putra Abu Quhafah (Abu ABakar) telah mengenakan busana kekhilafahan itu, padahal ia tahu bahwa kedudukanku sehubungan dengan itu adalah bagaikan kedudukan poros pada penggiling. Air bah mengalir dariku dan burung tak dapat terbang sampai kepadaku. Maka aku mengulur tabir terhadap kekhilafahan dan melepaskan diri darinya. Kemudian aku mulai berpikir, apakah aku harus menyerang dengan tangan terputus atau bersabar atas kegelapan yang membutakan, dimana orang dewasa menjadi tua bangka dan anak kecil menjadi beruban dan orang mukmin yang sesungguhnya hidup dalam tekanan sampai ia menemui Tuhannya!
Maka aku dapati bahwa bersabar atasnya lebih bijaksana. Maka aku bersabar, walaupun ia menusuk mata dan mencekik kerongkongan. Aku menyaksikan warisanku dirampok … “ [1]
.
Kedua, sikap enggan memberikan baiat itu sudah cukup membuktikan hak kewalian beliau yang mereka bekukan
.
Dan ketiga, mengingat maslahat umat Islam menuntut agar beliau mengorbankan hak beliau demi meraih maslahat Islam yang lebih abadi. Sebab eksistenti kaum Muslimin dan Dawlah Islam sedang terancam dengan maraknya kaum murtad yang meninggalkan agama Islam dan berniat untuk menyerang kota suci Madinah dan memerangi kaum Muslim!
.
Dalam sebuah pernyataannya, Imam Ali as. menjelaskan sebab mengapa beliau sudi memberikan baiat untuk Abu Bakar:
فأَمْسَكْتُ يدي حتَّى رأيتُ راجِعَةَ الناسِ قد رجعت عن الإسلامِ , يدعون إلى مَحقِ دين محمد (ص), فَخَشيتُ إن لم أنصرِ الإسلامِ و أهلَه أن أرى فيه ثَلْمًا أو هدمًا تكون المصيبةُ بِهِ عليَّ أعظَم من فوتِ ولايَتِكم.
“Dan ketika aku saksikan kemurtadan orang-orang telah kembali meninggalkan Islam, mereka mengajak kepada pemusnahan agama Muhammad saw., maka aku khawatir jika aku tidak membela Islam dan para  pemeuluknya aku akan menyaksikan celah atau keruntuhan Islam yang bencananya atasku lebih besar dari sekedar hilangnya kekuasaan atas kalian.”[2]
.
Inilah sebabh hkiki dalam maalah ini, bukan seperti yang diasumsikan sebagian orang
.
Adapaun tuduhan Syeikh bahwa dengan demikian kaum Syi’ah menuduh Imam mereka bersikap pengecut, maka kesimpulan miring itu sama sekali tidak berdasar, sebab pada diri Nabi Harun as. terdapat uswah, teladah baik bagi Imam Ali as. ketika beliau berkata, seperti diabadikan dalam Al Qur’an:
وَ لَمَّا رَجَعَ مُوسى‏ إِلى‏ قَوْمِهِ غَضْبانَ أَسِفاً قالَ بِئْسَما خَلَفْتُمُوني‏ مِنْ بَعْدي أَ عَجِلْتُمْ أَمْرَ رَبِّكُمْ وَ أَلْقَى الْأَلْواحَ وَ أَخَذَ بِرَأْسِ أَخيهِ يَجُرُّهُ إِلَيْهِ قالَ ابْنَ أُمَّ إِنَّ الْقَوْمَ اسْتَضْعَفُوني‏ وَ كادُوا يَقْتُلُونَني‏ فَلا تُشْمِتْ بِيَ الْأَعْداءَ وَ لا تَجْعَلْني‏ مَعَ الْقَوْمِ الظَّالِمينَ 
“Dan tatkala Musa telah kembali kepada kaumnya dengan marah dan sedih hati berkatalah dia: “Alangkah buruknya perbuatan yang kamu kerjakan sesudah kepergianku! Apakah kamu hendak mendahului janji Tuhanmu?” Dan Musa pun melemparkan luh-luh (Taurat) itu dan memegang (rambut) kepala saudaranya (Harun) sambil menariknya ke arahnya. Harun berkata: “Hai anak ibuku, sesungguhnya kaum ini telah menganggapku lemah dan hampir-hampir mereka membunuhku, sebab itu janganlah kamu menjadikan musuh-musuh gembira melihatku, dan janganlah kamu masukkan aku ke dalam golongan orang-orang yang lalim.” (QS.A’râf [7];150) 
.
Imam Ali as. mengalami kondisi serupa dengan parnah dialami oleh Nabi Harun as. ketika kaumnya membangkang dengan kesesatan akibat provokasi Samiri
.
Ketertindasan dan ketidak-berdayaan Imam Ali as. itu telah diberitakan Nabi saw. dalam banyak sabda beliau, di antaranya adalah hadis yang sangat terkenal yang berbunyi:
أنتم المستَضْغَفٌون بَعدي
“Sepeninggalku, kalian akan ditindas.”[3]
.
Nabi saw. Mengabarkan Bahwa Umat Akan Mengkhianati Imam Ali as. 
Bahkan lebih dari itu, Nabi saw. telah memberitakan dari balik tirai ghaib, bahwa umat ini akan menelantarkan Ali as. dan tidak memberikan kesetian pembelaan untuknya. Mereka akan mengkhianatinya!
.
Imam Ali as. berulang kali mengatakan:
إنّه ممّا عهد إليّ النبي (صلى الله عليه وآله وسلم) أنّ الاُمّة ستغدر بي بعده.
 “Termasuk yang dijanjikan Nabi kepadaku bahwa umat akan mengkhianatiku sepeninggal beliau.” 
Hadis ini telah diriwayatkan dan dishahihkan al Hakim dan adz Dzahabi. Ia berkata:
صحيح الاسناد
“Hadis ini sahih sanadnya.”
.
Adz Dzahabi pun menshahihkannya. Ia berkata:
صحيح
“Hadis ini shahih.” [4]
Sebagaimana juga diriwayatkan oleh Ibnu Abi Syaibah, al Bazzâr, ad Dâruquthni, al Khathib al Baghdâdi, al Baihaqi dkk.
.
Nabi saw. Mengabarkan Bahwa Umat Akan Menuangkan Kedengkian Mereka Kepada Imam Ali as.
Demikian juga, sebagian orang yang memendam dendam kusumat dan kebencian kepada Nabi saw. akan menuangkannya kepada Imam Ali as., dan puncaknya akan mereka lakukan sepeninggal Nabi saw
.
Kenyataan itu telah diberitakan Nabi saw. kepada Ali as. Para ulama meriwayatkan banyak hadis tentangnya, di antaranya adalah hadis di bawah ini
:
Imam Ali as. berkata:
بينا رسول الله (صلى الله عليه وسلم) آخذ بيدي ونحن نمشي في بعض سكك المدينة، إذ أتينا على حديقة، فقلت: يا رسول الله ما أحسنها من حديقة ! فقال: إنّ لك في الجنّة أحسن منها، ثمّ مررنا بأُخرى فقلت: يا رسول الله ما أحسنها من حديقة ! قال: لك في الجنّة أحسن منها، حتّى مررنا بسبع حدائق، كلّ ذلك أقول ما أحسنها ويقول: لك في الجنّة أحسن منها، فلمّا خلا لي الطريق اعتنقني ثمّ أجهش باكياً، قلت: يا رسول الله ما يبكيك ؟ قال: ضغائن في صدور أقوام لا يبدونها لك إلاّ من بعدي، قال: قلت يا رسول الله في سلامة من ديني ؟ قال: في سلامة من دينك.
“Ketika Rasulullah saw. memegang tanganku, ketika itu kami sedang berjalan-jalan di sebagian kampong kota Madinah, kami mendatangi sebuah kebun, aku berkata, ‘Wahai Rasulullah alangkah indahnya kebun ini!’ Maka beliau bersabda, ‘Untukmu di surga lebih indah darinya.’ Kemudian kami melewati tujuh kebun, dan setiap kali aku mengatakannya, ‘Alangkah indahnya’ dan nabi pun bersabda, ‘Untukmu di surga lebih indah darinya.’ Maka ketika kami berda di tempat yang sepi, Nabi saw. memelukku dan sepontan menangis. Aku berkata, ‘Wahai Rrasulullah, gerangan apa yang menyebabkan Anda menangis?’ Beliau menjawab, ‘Kedengkian-kedengkian yang ada di dada-dada sebagian kaum yang tidak akan mereka tampakkan kecuali setelah kematianku.’ Aku berkata, ‘Apakah dalam keselamatan dalam agamaku?’ Beliau menjawab, ‘Ya. Dalam keselamatan agamamu.’”
Hadis ini diriwayatkan oleh Abu Ya’la, al Bazzâr dengan sanad shahih, al Hakim dan adz Dzahabi dan mereka menshahihkannya,[5] Ibnu Hibbân dkk. [6]
Ia juga disebutkan oleh asy Syablanji dalam kitab Nûr al Abshârnya:88
.
Jadi jelaslah bagi kita apa yang sedang dialami oleh Imam Ali as. dari sebagian umat ini!

Tahukah anda kaum sunni, dlm kitab anda yg paling sahih, tercatat bagaimana Umar meragukan kenabian Junjungan Nabi Muhammad saaw saat perjanjian Hudaibiyah? Dan anda memujinya dgn pelbagai gelaran dan kehebatan…

.

Nabi saw telah menubuwahkan  nasib yang bakal menimpa Imam Ali a.s selepas Baginda saw wafat nanti, seperti  hadis berikut:

1. Rasulullah SAW melalui lisan sucinya telah mengabarkan kepada Imam Ali, bagaimana kondisi Imam Ali sepeninggal Beliau SAW. Beliau saaw mengatakan bahwa Imam Ali akan mengalami kesukaran atau kesulitan sepeninggal Beliau SAW. Hal ini diriwayatkan dalam kabar shahih yang tercatat dalam kitab Al Mustadrak Al Hakim 3/151 no 4677
أخبرنا أحمد بن سهل الفقيه البخاري ثنا سهل بن المتوكل ثنا أحمد بن يونس ثنا محمد بن فضيل عن أبي حيان التيمي عن سعيد بن جبير عن ابن عباس رضي الله عنهما قال : قال النبي صلى الله عليه و سلم لعلي أما أنك ستلقى بعدي جهدا قال في سلامة من ديني ؟ قال : في سلامة من دينك

Telah mengabarkan kepada kami Ahmad bin Sahl seorang faqih dari Bukhara yang berkata telah menceritakan kepada kami Sahl bin Mutawwakil yang berkata telah menceritakan kepada kami Ahmad bin Yunus yang berkata telah menceritakan kepada kami Muhammad bin Fudhail dari Abi Hayyan At Taimi dari Sa’id bin Jubair dari Ibnu Abbas RA yang berkata Nabi saaw berkata kepada Ali “Sesungguhnya kamu akan mengalami kesukaran (bersusah payah) sepeninggalKu”. Ali bertanya “apakah dalam keselamatan agamaku?”. Nabi saaw menjawab “dalam keselamatan agamamu”

.

2. Rasulullah SAW telah mengabarkan kepada Imam Ali bahwa sepeninggal Beliau SAW, umat akan mengkhianati Imam Ali. Hal ini telah dinyatakan dalam hadis-hadis shahih. Salah satunya dalam hadis berikut
حدثنا أبو حفص عمر بن أحمد الجمحي بمكة ثنا علي بن عبد العزيز ثنا عمرو بن عون ثنا هشيم عن إسماعيل بن سالم عن أبي إدريس الأودي عن علي رضى الله تعالى عنه قال إن مما عهد إلي النبي صلى الله عليه وسلم أن الأمة ستغدر بي بعده
Telah menceritakan kepada kami Abu Hafsh Umar bin Ahmad Al Jumahi di Makkah yang berkata telah menceritakan kepada kami Ali bin Abdul Aziz yang berkata telah menceritakan kepada kami Amru bin ‘Aun yang berkata telah menceritakan kepada kami Husyaim dari Ismail bin Salim dari Abi Idris Al Awdi dari Ali Radhiyallahu ‘anhu yang berkata “Diantara yang dijanjikan Nabi SAW kepadaku bahwa Umat akan mengkhianatiku sepeninggal Beliau”. [Hadis riwayat Al Hakim dalam Al Mustadrak 3/150 no 4676 dishahihkan oleh Al Hakim dan Adz Dzahabi dalam At Talkhis]

.

Hadis ini adalah hadis yang shahih sebagaimana yang dikatakan oleh Al Hakim dan Adz Dzahabi. Selain itu hadis ini juga diriwayatkan oleh Ad Dulabi dalam Al Kuna Wal Asmaa’ 2/442 no 441

حدثنا يحيى بن غيلان ، عن أبي عوانة ، عن إسماعيل بن سالم ، وحدثنا فهد بن عوف ، قال ، ثنا أبو عوانة ، عن إسماعيل بن سالم ، عن أبي إدريس إبراهيم بن أبي حديد الأودي أن علي بن أبي طالب ، قال : عهد إلي النبي صلى الله عليه وسلم أن الأمة ستغدر بي من بعده
Telah menceritakan kepada kami Yahya bin Ghailan dari Abu ‘Awanah dari Ismail bin Salim dan telah menceritakan kepada kami Fahd bin Auf yang berkata telah menceritakan kepada kami Abu ‘Awanah dari Ismail bin Salim dari Abi Idris Ibrahim bin Abi Hadid Al Awdi bahwa Ali bin Abi Thalib berkata “telah dijanjikan oleh Nabi SAW bahwa Umat akan mengkhianatiku sepeninggal Beliau”

.

3. Selain diriwayatkan oleh Ibrahim bin Abi Hadid, hadis tersebut juga diriwayatkan oleh Tsa’labah bin Yazid Al Himmani. Hadis Tsa’labah diriwayatkan dalam Tarikh Dimasyq Ibnu Asakir 42/447, Musnad Al Bazzar 3/91, Dalail Nubuwwah Baihaqi 7/312 no 2759 dan Al Kamil Ibnu Ady 6/216. Berikut sanad hadis Tsa’labah bin Yazid yang terdapat dalam kitab Al Mathalib Al Aliyah Ibnu Hajar 11/205 no 4018
حدثنا الفضل هو أبو نعيم ثنا فطر بن خليفة أخبرني حبيب بن أبي ثابت قال سمعت ثعلبة بن يزيد قال سمعت عليا يقول والله إنه لعهد النبي الأمي صلى الله عليه وسلم
Telah menceritakan kepada kami Fadhl (dia Abu Nu’aim) yang berkata telah menceritakan kepada kami Fithr bin Khalifah yang berkata telah mengabarkan kepadaku Habib bin Abi Tsabit yang berkata aku mendengar Tsa’labah bin Yazid berkata aku mendengar Ali mengatakan Demi Allah, sesungguhnya Nabi yang ummi telah menjanjikan kepadaku….(sama spt teks dlm hadis di atas)

.

Dengan ini, maka Imam Ali a.s telah tahu dan bersedia menghadapi pengkhianatan umat ke atas beliau a.s…

Namun, utk mengatakan bahawa beliau tidak menyebutkan hak2 dan keutamaan beliau kpd umat, adalah suatu yg mengelirukan, karena beliau a.s dlm banyak kesempatan, telah menyebutkannya

.

Diriwayatkan dengan sanad yang shahih bahwa Imam Ali mengakui kalau dirinya adalah orang yang paling berhak dalam urusan kepemimpinan sepeninggal Nabi SAW. Tetapi walaupun begitu demi kemaslahatan umat islam, Beliau tetap pada akhirnya memberikan baiat kepada para khalifah yaitu Abu Bakar RA, Umar RA dan Utsman RA. Hal ini tentu saja bertujuan agar tidak terjadi perpecahan di kalangan kaum muslimin. Sebagian orang yang ingkar menjadikan baiat-nya Imam Ali sebagai alasan untuk membenarkan kepemimpinan ketiga khalifah. Sebaik-baik bantahan bagi mereka adalah pernyataan Imam Ali sendiri yang mengakui kalau ia adalah orang yang paling berhak sepeninggal Nabi SAW bukan Abu Bakar, bukan Umar dan bukan pula Utsman

.
حدثني روح بن عبد المؤمن عن أبي عوانة عن خالد الحذاء عن عبد الرحمن بن أبي بكرة أن علياً أتاهم عائداً فقال ما لقي أحد من هذه الأمة ما لقيت توفي رسول الله صلى الله عليه وسلم وأنا أحق الناس بهذا الأمر فبايع الناس أبا بكر فاستخلف عمر فبايعت ورضيت وسلمت ثم بايع الناس عثمان فبايعت وسلمت ورضيت وهم الآن يميلون بيني وبين معاوية
Telah menceritakan kepadaku Rawh bin Abdul Mu’min dari Abi Awanah dari Khalid Al Hadzdza’ dari Abdurrahman bin Abi Bakrah bahwa Ali mendatangi mereka dan berkata “Tidak ada satupun dari umat ini yang mengalami seperti yang saya alami. Rasulullah SAW wafat dan sayalah yang paling berhak dalam urusan ini . Kemudian orang-orang membaiat Abu Bakar terus Umar menggantikannya, maka akupun ikut membaiat, pasrah dan menerima. Kemudian orang-orangpun membaiat Utsman maka akupun ikut membaiat, pasrah dan menerima. Dan sekarang mereka bingung antara aku dan Muawiyah” [Ansab Al Asyraf Al Baladzuri 1/294]

.
Imam Ali as. Mengeluhkan Pengkhiatanan Suku Quraisy!
Dalam banyak pernyataannya, Imam Ali as. telah mengeluhkan kedengkian, kejahatan dan sikap arogan suku Quraisy terhadap Nabi saw. yang kemudian, ketika mereka tidak mendapatkan jalan untuk meluapkannya kepada beliau saw., mereka meluapkan dendanm kusumat kekafiran dan kemunafikan kepadanya as
.
Di bawah ini akan saya sebutkan sebuah kutipan pernyataan beliau as. tersebut.
اللهمّ إنّي أستعديك على قريش، فإنّهم أضمروا لرسولك (صلى الله عليه وآله وسلم) ضروباً من الشر والغدر، فعجزوا عنها، وحُلت بينهم وبينها، فكانت الوجبة بي والدائرة عليّ، اللهمّ احفظ حسناًوحسيناً، ولا تمكّن فجرة قريش منهما ما دمت حيّاً، فإذا توفّيتني فأنت الرقيب عليهم وأنت على كلّ شيء شهيد.
“Ya Allah, aku memohon dari Mu agar melawan Quraisy, karena mereka telah memendam bermacam sikpa jahat dan pengkhianatan kepada Rasul-Mu saw., lalu mereka lemah dari meluapkannya, dan Engkau menghalang-halangi mereka darinya, maka dicicipkannya kepadaku dan dialamatkannya ke atasku. Ya Allah peliharalah Hasan dan Husain, jangan Engkau beri kesempatan orang-orang durjana dari Quraisy itu membinasakan keduanya selagi aku masih hidup. Dan jika Engkau telah wafatkan aku, maka Engkau-lah yang mengontrol mereka, dan Engkau Maha Menyaksikan segala sesuatu.”[7]
Coba Anda perhatikan pernyataan Imam Ali as. di atas, bagaimana dendam dan pengkhianatan Quraisy terhadap Nabi saw. akan mereka luapkan kepadanya! Dan di dalamnya juga terdapat penegasan bahwa mereka tidak segan-segan akan menghabisi nyawa bocah-bocah mungil kesayangan Rasulullah saw.; Hasan dan Husain as. yang akan meneruskan garis keturunan kebanian sebagai melampiasan dendam mereka kepada Nabi saw.!
.
[1]Nahjul Balaghah, pidato ke3.
[2] Ibid. pidato ke74.
[3] Musnad Ahmad,6/339.
[4] Mustadrak al Hakim,3/140 dan 142.
[5] Al Mustadrak,3/139 hanya saja bagian akhir radaksi hadis ini terpotong, sepertinya ada “tangan-tangan terampil” yang sengaja menyensor hadis di atas.
[6]Teks hadis di atas sesuai dengan yang terdapat Majma’ az Zawâid,9/118.
[7] Syarah Nahjul Balaghhah, 20/298

………………………..

Rangkuman Riwayat Kebenaran 12 Imam Ahlilbait as

Kedudukan Hadis “Imam Ali Pemimpin Bagi Setiap Mukmin Sepeninggal Nabi SAW”

Diriwayatkan dengan berbagai jalan yang shahih dan hasan bahwa Rasulullah SAW bersabda kalau Imam Ali adalah Pemimpin bagi setiap mukmin sepeninggal Beliau SAW. Hadis tersebut diriwayatkan oleh Imran bin Hushain RA, Buraidah RA, Ibnu Abbas RA dan Wahab bin Hamzah RA. Rasulullah SAW bersabda

إن عليا مني وأنا منه وهو ولي كل مؤمن بعدي

Ali dari Ku dan Aku darinya dan Ia adalah Pemimpin bagi setiap mukmin sepeninggalKu.

.

Takhrij Hadis

Hadis di atas adalah lafaz riwayat Imran bin Hushain RA. Disebutkan dalam Musnad Abu Dawud Ath Thayalisi 1/111 no 829, Sunan Tirmidzi 5/296, Sunan An Nasa’i 5/132 no 8474, Mushannaf Ibnu Abi Syaibah 7/504, Musnad Abu Ya’la 1/293 no 355, Shahih Ibnu Hibban 15/373 no 6929, Mu’jam Al Kabir Ath Thabrani 18/128, dan As Sunnah Ibnu Abi Ashim no 1187. Semuanya dengan jalan sanad yang berujung pada Ja’far bin Sulaiman dari Yazid Ar Risyk dari Mutharrif bin Abdullah bin Syikhkhir Al Harasy dari Imran bin Hushain RA. Berikut sanad Abu Dawud

حدثنا جعفر بن سليمان الضبعي ، حدثنا يزيد الرشك ، عن مطرف بن عبد الله بن الشخير ، عن عمران بن حصين

Telah menceritakan kepada kami Ja’far bin Sulaiman Ad Dhuba’iy  yang berkata telah menceritakan kepada kami Yazid Ar Risyk dari Mutharrif bin Abdullah bin Syikhkhir dari Imran bin Hushain-alhadis- [Musnad Abu Dawud Ath Thayalisi no 829]

Hadis Imran bin Hushain ini sanadnya shahih karena para perawinya tsiqat

  • Ja’far bin Sulaiman Adh Dhuba’iy adalah seorang yang tsiqat. Ja’far adalah perawi Bukhari dalam Adabul Mufrad, Muslim dan Ashabus Sunan. Ibnu Ma’in, Ibnu Sa’ad, Ibnu Madini dan Ibnu Hibban menyatakan ia tsiqat. Ahmad bin Hanbal berkata “tidak ada masalah padanya”. Abu Ahmad mengatakan kalau Ja’far hadisnya baik, ia memiliki banyak riwayat dan hadisnya hasan [At Tahdzib juz 2 no 145]. Al Ajli menyatakan Ja’far bin Sulaiman tsiqat [Ma’rifat Ats Tsiqat no 221]. Ibnu Syahin juga memasukkannya sebagai perawi tsiqat [Tarikh Asma Ats Tsiqat no 166]. Kelemahan yang dinisbatkan kepada Ja’far adalah ia bertasayyyu’ tetapi telah ma’ruf diketahui bahwa tasyayyu’ Ja’far dikarenakan ia banyak meriwayatkan hadis-hadis keutamaan Ahlul Bait. Ibnu Hajar menyatakan ia shaduq tasyayyu’ [At Taqrib 1/162]. Adz Dzahabi menyatakan Ja’far bin Sulaiman tsiqat [Al Kasyf no 729]
  • Yazid Ar Risyk adalah Yazid bin Abi Yazid Adh Dhuba’iy seorang yang tsiqat perawi kutubus sittah. Tirmidzi, Abu Hatim, Abu Zar’ah, Ibnu Hibban dan Ibnu Sa’ad menyatakan ia tsiqah. Ahmad bin Hanbal menyatakan ia “shalih al hadis”.[At Tahdzib juz 11 no 616]. Disebutkan kalau Ibnu Ma’in mendhaifkannya tetapi hal ini keliru karena telah diriwayatkan dengan sanad yang shahih kalau Ibnu Ma’in justru menta’dilkannya. Ibnu Abi Hatim menukil Ad Dawri dari Ibnu Ma’in yang menyatakan Yazid “shalih” dan menukil Abu Bakar bin Abi Khaitsamah dari Ibnu Main yang menyatakan Yazid “laisa bihi ba’sun”. perkataan ini berarti perawi tersebut tsiqah menurut Ibnu Ma’in. [Al Jarh Wat Ta’dil 9/298 no 1268].
  • Mutharrif bin Abdullah adalah tabiin tsiqah perawi kutubus sittah. Ibnu Sa’ad menyatakan ia tsiqah. Al Ajli mengatakan ia tsiqah. Ibnu Hibban memasukkannya dalam Ats Tsiqah. [At Tahdzib juz 10 no 326]. Ibnu Hajar menyatakan Mutharrif bin Abdullah tsiqah [At Taqrib 2/188].

Hadis Imran bin Hushain di atas jelas sekali diriwayatkan oleh perawi tsiqah dan shahih sesuai dengan syarat Imam Muslim. Ja’far bin Sulaiman adalah perawi Muslim dan yang lainnya adalah perawi Bukhari dan Muslim. Ibnu Hajar menyatakan sanad hadis ini kuat dalam kitabnya Al Ishabah 4/569. Syaikh Al Albani menyatakan hadis ini shahih [Zhilal Al Jannah Takhrij As Sunnah no 1187]. Syaikh Syu’aib Al Arnauth menyatakan hadis ini sanadnya kuat [Shahih Ibnu Hibban no 6929]. Syaikh Husain Salim Asad menyatakan hadis ini para perawinya perawi shahih [Musnad Abu Ya’la no 355]

Selain riwayat Imran bin Hushain, hadis tersebut juga diriwayatkan oleh Buraidah RA. Hadis Buraidah disebutkan dalam Musnad Ahmad 5/356 no 22908[tahqiq Ahmad Syakir dan Hamzah Zain], Sunan Nasa’i 5/132 no 8475, Tarikh Ibnu Asakir 42/189 dengan jalan sanad yang berujung pada Ajlah Al Kindi dari Abdullah bin Buraidah dari ayahnya. Berikut sanad riwayat Ahmad

ثنا بن نمير حدثني أجلح الكندي عن عبد الله بن بريدة عن أبيه بريدة قال

Telah menceritakan kepada kami Ibnu Numair yang berkata telah menceritakan kepadaku Ajlah Al Kindi dari Abdullah bin Buraidah dari Ayahnya Buraidah yang berkata-hadis marfu’-[Musnad Ahmad 5/356 no 22908]

Hadis Buraidah ini sanadnya hasan karena diriwayatkan oleh perawi yang tsiqah yaitu Ibnu Numair dan Abdullah bin Buraidah dan perawi yang hasan yaitu Ajlah Al Kindi.

  • Ibnu Numair adalah Abdullah bin Numair Al Hamdani adalah perawi kutubus sittah yang dikenal tsiqah. Ibnu Ma’in, Ibnu Hibban, Al Ajli dan Ibnu Sa’ad menyatakan ia tsiqah. [At Tahdzib juz 6 no 110]. Ibnu Hajar menyatakan ia tsiqat [At Taqrib 1/542]. Adz Dzahabi menyatakan ia hujjah [Al Kasyf no 3024]
  • Ajlah Al Kindi adalah seorang yang shaduq. Ibnu Main dan Al Ajli menyatakan ia tsiqat. Amru bin Ali menyatakan ia seorang yang shaduq dan hadisnya lurus. Ibnu Ady berkata “ia memiliki hadis-hadis yang shalih, telah meriwayatkan darinya penduduk  kufah dan yang lainnya, tidak memiliki riwayat mungkar baik dari segi sanad maupun matan tetapi dia seorang syiah kufah, disisiku ia seorang yang shaduq dan hadisnya lurus”. Yaqub bin Sufyan menyatakan ia tsiqat tetapi ada kelemahan dalam hadisnya. Diantara yang melemahkannya adalah Ibnu Sa’ad, Abu Hatim, Abu Dawud dan An Nasa’i. [At Tahdzib juz 1 no 353]. Abu Hatim dan An Nasa’i menyatakan ia “tidak kuat” dimana perkataan ini bisa berarti seorang yang hadisnya hasan apalagi dikenal kalau Abu Hatim dan Nasa’i termasuk ulama yang ketat dalam menjarh. Ibnu Sa’ad dan Abu Dawud menyatakan ia dhaif tanpa menyebutkan alasannya sehingga jarhnya adalah jarh mubham. Tentu saja jarh mubham tidak berpengaruh pada mereka yang telah mendapat predikat tsiqat dari ulama yang mu’tabar. Ibnu Hajar menyatakan ia seorang syiah yang shaduq [At Taqrib 1/72]. Adz Dzahabi juga menyatakan Ajlah seorang yang shaduq [Man Tukullima Fiihi Wa Huwa Muwatstsaq no 13]. Bagi kami ia seorang yang tsiqah atau shaduq, Bukhari telah menyebutkan biografinya tanpa menyebutkan cacatnya [Tarikh Al Kabir juz 2 no 1711]. Hal ini menunjukkan kalau jarh terhadap Ajlah tidaklah benar dan hanya dikarenakan sikap tasyayyu’ yang ada padanya.
  • Abdullah bin Buraidah adalah seorang tabiin yang tsiqah. Ibnu Ma’in, Al Ajli dan Abu Hatim menyatakan ia tsiqat. Ibnu Kharasy menyatakan ia shaduq [At Tahdzib juz 5 no 270]. Ibnu Hajar menyatakan ia tsiqat [At Taqrib 1/480] dan Adz Dzahabi juga menyatakan ia tsiqat [Al Kasyf no 2644].

Sudah jelas hadis Buraidah ini adalah hadis hasan yang naik derajatnya menjadi shahih dengan penguat hadis-hadis yang lain. Syaikh Al Albani menyatakan bahwa hadis Buraidah ini sanadnya jayyid [Zhilal Al Jannah Takhrij As Sunnah no 1187].

Selain Imran bin Hushain dan Buraidah, hadis ini juga diriwayatkan oleh Ibnu Abbas dengan sanad yang shahih. Riwayat Ibnu Abbas disebutkan dalam Musnad Abu Dawud Ath Thayalisi 1/360 no 2752, Tarikh Ibnu Asakir 42/199, dan Tarikh Ibnu Asakir 42/201, Musnad Ahmad 1/330 no 3062, Al Mustadrak 3/143 no 4652, As Sunnah Ibnu Abi Ashim no 1188, dan Mu’jam Al Kabir 12/77. Berikut sanad riwayat Abu Dawud

حدثنا أبو عوانة عن أبي بلج عن عمرو بن ميمون عن بن عباس ان رسول الله صلى الله عليه و سلم

Telah menceritakan kepada kami Abu Awanah dari Abi Balj dari Amru bin Maimun dari Ibnu Abbas bahwa Rasulullah SAW bersabda [Musnad Abu Dawud Ath Thayalisi no 2752]

Hadis Ibnu Abbas ini sanadnya shahih dan diriwayatkan oleh para perawi yang tsiqat.

  • Abu Awanah adalah Wadhdhah bin Abdullah Al Yasykuri seorang perawi kutubus sittah yang tsiqat. Abu Hatim, Abu Zar’ah, Ahmad, Ibnu Sa’ad, Ibnu Abdil Barr menyatakan ia tsiqat. [At Tahdzib juz 11 no 204]. Al Ajli menyatakan ia tsiqah [Ma’rifat Ats Tsiqat no 1937].Ibnu Hajar menyatakan Abu Awanah tsiqat tsabit [At Taqrib 2/283] dan Adz Dzahabi juga menyatakan ia tsiqat [Al Kasyf no 6049].
  • Abu Balj adalah Yahya bin Sulaim seorang perawi Ashabus Sunan yang tsiqat. Ibnu Ma’in, Ibnu Sa’ad, Nasa’i dan Daruquthni menyatakan ia tsiqat. Abu Fath Al Azdi menyatakan ia tsiqat. Abu Hatim berkata “shalih laba’sa bihi”. Yaqub bin Sufyan berkata “tidak ada masalah padanya”. Al Bukhari berkata “fihi nazhar” atau perlu diteliti lagi hadisnya. [At Tahdzib juz 12 no 184]. Perkataan Bukhari ini tidaklah tsabit karena ia sendiri telah menuliskan biografi Abu Balj tanpa menyebutkan cacatnya bahkan dia menegaskan kalau Syu’bah meriwayatkan dari Abu Balj [Tarikh Al Kabir juz 8 no 2996]. Hal ini berarti Syu’bah menyatakan Abu Balj tsiqat karena ia tidak meriwayatkan kecuali dari perawi yang tsiqat. Ibnu Abdil Barr dan Ibnu Jauzi menyatakan bahwa Ibnu Main mendhaifkan Abu Balj [At Tahdzib juz 12 no 184]. Tentu saja perkataan ini tidak benar karena telah diriwayatkan dengan sanad yang shahih dari Ishaq bin Mansur kalau Ibnu Ma’in justru menyatakan Abu Balj tsiqat [Al Jarh Wat Ta’dil 9/153 no 634]. Kesimpulannya pendapat yang rajih adalah ia seorang yang tsiqat.
  • Amru bin Maimun adalah perawi kutubus sittah yang tsiqah. Al Ajli, Ibnu Ma’in, An Nasa’i dan Ibnu Hibban menyatakan ia tsiqat [At Tahdzib juz 8 no 181]. Ibnu Hajar menyatakan Amru bin Maimun tsiqat [At Taqrib 1/747].

Hadis Ibnu Abbas ini adalah hadis yang shahih dan merupakan sanad yang paling baik dalam perkara ini. Hadis ini juga menjadi bukti bahwa tasyayyu’ atau tidaknya seorang perawi tidak membuat suatu hadis lantas menjadi cacat karena sanad Ibnu Abbas ini termasuk sanad yang bebas dari perawi tasyayyu’. Hadis Ibnu Abbas ini telah dishahihkan oleh Al Hakim, Adz Dzahabi [Talkhis Al Mustadrak no 4652] dan Syaikh Ahmad Syakir [Musnad Ahmad no 3062].

Hadis dengan jalan yang terakhir adalah riwayat Wahab bin Hamzah. Diriwayatkan dalam Mu’jam Al Kabir Ath Thabrani 22/135, Tarikh Ibnu Asakir 42/199 dan Al Bidayah Wan Nihayah 7/381. Berikut jalan sanad yang disebutkan Ath Thabrani

حدثنا أحمد بن عمرو البزار وأحمد بن زهير التستري قالا ثنا محمد بن عثمان بن كرامة ثنا عبيد الله بن موسى ثنا يوسف بن صهيب عن دكين عن وهب بن حمزة قال

Telah menceritakan kepada kami Ahmad bin Amru Al Bazzar dan Ahmad bin Zuhair Al Tusturi yang keduanya berkata telah menceritakan kepada kami Muhammad bin Utsman bin Karamah yang berkata telah menceritakan kepada kami Ubaidillah bin Musa yang berkata telah menceritakan kepada kami Yusuf bin Shuhaib dari Dukain dari Wahab bin Hamzah yang berkata [Mu’jam Al Kabir 22/135]

Hadis ini diriwayatkan oleh para perawi tsiqat kecuali Dukain, ia seorang tabiin yang tidak mendapat predikat ta’dil dan tidak pula dicacatkan oleh para ulama.

  • Ahmad bin Amru Al Bazzar adalah penulis Musnad yang dikenal tsiqah, ia telah dinyatakan tsiqah oleh Al Khatib dan Daruquthni, Ibnu Qattan berkata “ia seorang yang hafizh dalam hadis [Lisan Al Mizan juz 1 no 750]
  • Ahmad bin Zuhair Al Tusturi adalah Ahmad bin Yahya bin Zuhair, Abu Ja’far Al Tusturi. Adz Dzahabi menyebutnya Al Imam Al Hujjah Al Muhaddis, Syaikh Islam. [As Siyar 14/362]. Dalam Kitab Tarajum Syuyukh Thabrani no 246 ia disebut sebagai seorang Hafizh yang tsiqat.
  • Muhammad bin Ustman bin Karamah seorang perawi yang tsiqat. Abu Hatim berkata “shaduq”. Maslamah dan Ibnu Hibban menyatakan ia tsiqat. Muhammad bin Abdullah bin Sulaiman dan Daud bin Yahya berkata “ia shaduq”. [At Tahdzib juz 9 no 563]. Ibnu Hajar menyatakan Muhammad bin Utsman bin Karamah tsiqat [At Taqrib 2/112]
  • Ubaidillah bin Musa adalah perawi kutubus sittah yang dikenal tsiqah. Ibnu Ma’in, Abu Hatim, Ibnu Hibban, Al Ajli, Ibnu Syahin, Utsman bin Abi Syaibah dan Ibnu Ady menyatakan ia tsiqah.[At Tahdzib juz 7 no 97]. Ibnu Hajar menyatakan Ubaidillah tsiqat tasyayyu’ [At Taqrib 1/640]. Adz Dzahabi juga menyatakan ia tsiqah [Al Kasyf no 3593].
  • Yusuf bin Shuhaib adalah seorang perawi tsiqat. Ibnu Ma’in, Abu Dawud, Ibnu Hibban, Utsman bin Abi Syaibah, Abu Nu’aim menyatakan ia tsiqat. Abu Hatim dan An Nasa’i berkata ‘tidak ada masalah padanya”. [At Tahdzib juz 11 no 710]. Ibnu Hajar menyatakan Yusuf bin Shubaih tsiqat [At Taqrib 2/344] dan Adz Dzahabi juga menyatakan Yusuf tsiqat [Al Kasyf no 6437]
  • Dukain adalah seorang tabiin. Hanya Ibnu Abi Hatim yang menyebutkan biografinya dalam Al Jarh Wat Ta’dil dan mengatakan kalau ia meriwayatkan hadis dari Wahab bin Hamzah dan telah meriwayatkan darinya Yusuf bin Shuhaib tanpa menyebutkan jarh maupun ta’dil terhadapnya. [Al Jarh Wat Ta’dil 3/439 no 1955]. Dukain seorang tabiin yang meriwayatkan hadis dari Wahab bin Hamzah dan sebagaimana disebutkan oleh Ibnu Sakan kalau Wahab bin Hamzah adalah seorang sahabat Nabi [Al Ishabah 6/623 no 9123]

Hadis Wahab bin Hamzah ini dapat dijadikan syawahid dan kedudukannya hasan dengan penguat dari hadis-hadis lain. Al Haitsami berkata mengenai hadis Wahab ini “Hadis riwayat Thabrani dan di dalamnya terdapat Dukain yang disebutkan oleh Ibnu Abi Hatim, tidak ada ulama yang mendhaifkannya dan sisanya adalah perawi yang dipercaya “ [Majma’ Az Zawaid 9/109].

.

.

Ibnu Taimiyyah Mendustakan Hadis Shahih

Jika kita mengumpulkan semua hadis tersebut maka didapatkan

  • Hadis Imran bin Hushain adalah hadis shahih [riwayat Ja’far bin Sulaiman]
  • Hadis Buraidah adalah hadis hasan [riwayatAjlah Al Kindi]
  • Hadis Ibnu Abbas adalah hadis shahih [riwayat Abu Balj]
  • Hadis Wahab bin Hamzah adalah hadis hasan [riwayat Dukain]

Tentu saja dengan mengumpulkan sanad-sanad hadis ini maka tidak diragukan lagi kalau hadis ini adalah hadis yang shahih. Dan dengan fakta ini ada baiknya kita melihat apa yang dikatakan Ibnu Taimiyyah tentang hadis ini, ia berkata

” أنت ولي كل مؤمن بعدي ” فهذا موضوع باتفاق أهل المعرفة بالحديث

“kamu adalah pemimpin bagi setiap mukmin sepeninggalKu” ini adalah maudhu’ (palsu) menurut kesepakatan ahli hadis [Minhaj As Sunnah 5/35]

قوله : هو ولي كل مؤمن بعدي كذب على رسول الله صلى الله عليه وسلم

Perkataannya ; “Ia pemimpin setiap mukmin sepeninggalku” adalah dusta atas Rasulullah SAW [Minhaj As Sunnah 7/278]

Cukuplah kiranya pembaca melihat dengan jelas siapa yang sebenarnya sedang berdusta atau sedang mendustakan hadis shahih hanya karena hadis tersebut dijadikan hujjah oleh orang syiah. Penyakit seperti ini yang dari dulu kami sebut sebagai “Syiahpobhia”.

.

.

Singkat Tentang Matan Hadis

Setelah membicarakan hadis ini ada baiknya kami membicarakan secara singkat mengenai matan hadis tersebut. Salafy nashibi biasanya akan berkelit dan berdalih kalau hadis tersebut tidak menggunakan lafaz khalifah tetapi lafaz waliy dan ini bermakna bukan sebagai pemimpin atau khalifah. Kami tidak perlu berkomentar banyak mengenai dalih ini, cukuplah kiranya kami bawakan dalil shahih kalau kata Waliy sering digunakan untuk menunjukkan kepemimpinan atau khalifah

Diriwayatkan oleh Ibnu Katsir [dan beliau menshahihkannya] dalam Al Bidayah wan Nihayah bahwa ketika Abu Bakar dipilih sebagai khalifah, ia berkhutbah

قال أما بعد أيها الناس فأني قد وليت عليكم ولست بخيركم

Ia berkata “Amma ba’du, wahai manusia sekalian sesungguhnya aku telah dipilih menjadi pimpinan atas kalian dan bukanlah aku yang terbaik diantara kalian. [Al Bidayah wan Nihayah 5/269]

Diriwayatkan pula oleh Ahmad bin Hanbal dalam Musnad Ahmad bin Hanbal bahwa Jabir bin Abdullah RA menyebutkan kepemimpinan Umar dengan kata Waliy

ثنا بهز قال وثنا عفان قالا ثنا همام ثنا قتادة عن عن أبي نضرة قال قلت لجابر بن عبد الله ان بن الزبير رضي الله عنه ينهى عن المتعة وان بن عباس يأمر بها قال فقال لي على يدي جرى الحديث تمتعنا مع رسول الله صلى الله عليه و سلم قال عفان ومع أبي بكر فلما ولي عمر رضي الله عنه خطب الناس فقال ان القرآن هو القرآن وان رسول الله صلى الله عليه و سلم هو الرسول وأنهما كانتا متعتان على عهد رسول الله صلى الله عليه و سلم إحداهما متعة الحج والأخرى متعة النساء

Telah menceritakan kepada kami Bahz dan telah menceritakan kepada kami Affan , keduanya [Bahz dan Affan] berkata telah menceritakan kepada kami Hamam yang berkata telah menceritakan kepada kami Qatadah dari Abi Nadhrah  yang berkata “aku berkata kepada Jabir bin Abdullah RA ‘sesungguhnya Ibnu Zubair telah melarang mut’ah dan Ibnu Abbas memerintahkannya’. Abu Nadhrah berkata ‘Jabir kemudian berkata kepadaku ‘kami pernah bermut’ah bersama Rasulullah’. [Affan berkata] “ dan bersama Abu Bakar. Ketika Umar menjadi pemimpin orang-orang, dia berkata ‘sesungguhnya Al Qur’an adalah Al Qur’an dan Rasulullah SAW adalah Rasul dan sesungguhnya ada dua mut’ah pada masa Rasulullah SAW, salah satunya adalah mut’ah haji dan yang satunya adalah mut’ah wanita’. [Musnad Ahmad 1/52 no 369 dishahihkan oleh Syaikh Syu’aib Al Arnauth dan Syaikh Ahmad Syakir]

Kedua riwayat di atas dengan jelas menunjukkan bahwa kata Waliy digunakan untuk menyatakan kepemimpinan para Khalifah seperti Abu Bakar dan Umar. Oleh karena itu tidak diragukan lagi bahwa hadis di atas bermakna Imam Ali adalah Pemimpin bagi setiap mukmin sepeninggal Nabi SAW.

1). Perumpamaan ahlilbaitku seperti perahu nuh, yang menaikinya selamat dan yang meninggalkannya tenggelam. (Al-Hakim, al-Mustadrak, ii, hlm. 343. Al-Dhahabi, al-Talkhis, ii, 345. al-Qunduzi al-Hanafi, Yanabi‘ al-Mawaddah , i, hlm. 27. al-Tabrani, al-Ausat, hlm. 216

.
2). Al-Bukhari, Sahih, viii, hlm. 384-385. ‘‘Sesungguhnya mereka (para sahabat) telah menjadi murtad selepasmu (irtaddu ba‘da-ka). Hanya sedikit daripada mereka yang terselamat seperti unta yang tersesat daripada pengembalanya”. Ia sejajar dengan firman-Nya Surah al-Saba’ (34):13 ‘‘Dan sedikit sekali daripada hamba-hamba-Ku yang bersyukur”
.
3). Sesungguhnya Allah Ta‘ala telah memandang ke Bumi, lalu Dia memilihku di kalangan mereka dan menjadikan aku seorang Nabi. Kemudian Dia memandang ke Bumi kali kedua, lalu Dia telah memilih suamimu dan Dia telah memerintahkanku supaya menikahkanmu dengannya. Dia telah memerintahkanku mengambilnya sebagai saudara, wazirwasi dan menjadikanya khalifahku pada umatku setelahku. Justeru itu, ayahmu ini adalah sebaik-baik Nabi Allah dan Rasul-Nya. Sementara suamimu adalah sebaik-baik wasi dan wazir. Al-Muttaqi al-Hindi, Kanz al-‘Ummal, vi, hlm. 153. al-Hakim, al-Mustadrak, iii, 159. al-Kanji al-Syafi‘i, Kifayah al-Talib, hlm. 491
.
4). Dan engkau adalah orang pertama yang akan mengikutiku (wafat) di kalangan keluargaku. Kemudian Dia telah merenung ke Bumi kali ketiga, lalu Dia memilihmu dan sebelas lelaki daripada anak cucumu dan suamimu. Lantaran itu, engkau adalah penghulu wanita Syurga. Sementara dua anak lelakimu adalah penghulu pemuda Syurga. Aku, saudaraku dan sebelas para imam dan para wasiku sehingga Hari Kiamat semuanya menjadi pembimbing dan mendapat petunjuk. Wasi pertama selepas saudaraku, adalah al-Hasan kemudian al-Husain, kemudian sembilan daripada anak anak al-Husain berada dalam satu martabat di Syurga.       Al-Qunduzi al-Hanafi, Yanabi‘ al-Mawaddah, hlm. 447
.
5). Al-Bukhari, Sahih, viii, hlm. 378-385, (Bab fi al-Haudh), hadis no. 578, 584, 585, 586, 587 dan 590, telah meriwayatkan bahawa para sahabat Nabi Saw. telah menjadi kafir-murtad selepas kewafatannya. Hadis no. 585. ‘‘Aku akan mendahului kalian di Haudh. Sesiapa yang melalui di hadapanku akan meminumnya dan siapa yang telah meminumnya tidak akan dahaga selama-lamanya. Kelak sebilangan orang yang aku kenali dan mereka pula mengenaliku akan dikemukakan di hadapanku. Kemudian mereka (para sahabatku) dipisahkan daripadaku. Ketika itu aku akan berkata: Mereka itu adalah daripadaku (para sahabatku)
.
Dijawab: Sesungguhnya mereka telah melakukan bid‘ah-bid‘ah (ahdathu ba‘da-ka) selepas anda meninggalkan mereka. Maka aku bersabda: Terjauh, terjauh (daripada rahmat) mereka yang telah mengubahkan (ghayyara) Sunnahku selepasku. Di dalam riwayat yang lain, Nabi saw bersabda: Wahai Tuhanku! Sesungguhnya mereka adalah para sahabatku (ashabi)! Dijawab: Sesungguhnya anda tidak mengetahui bid‘ah- bid‘ah (ahdathu) yang telah dilakukan oleh mereka selepas anda. Sesungguhnya mereka telah menjadi kafir-murtad kebelakang”. Hadis no.587“Hanya sedikit daripada mereka terselamat seperti unta yang terpisah daripada pengembalanya.” Lihat juga Muslim, Sahih, iv, hlm.1793-6 (Kitab al-Fadha’il), hadis no. 26, 28, 29, 31 dan 32. Hadis no. 26.‘‘Kerana kamu tidak mengetahui apa yang telah dilakukan oleh mereka selepas anda meninggalkan mereka. Maka aku bersabda: Terjauhlah, terjauhlah (daripada rahmat) mereka yang telah mengubah (baddala) sunnahku selepasku”
.
6). al-Turmudhi al-Hanafi, al-Kaukab al-Durriyy, hlm. 143, meriwayatkan sebuah hadis: ‘‘Ali adalah saudaraku, khalifahku dan pewaris ilmuku”.
6). Al-Qunduzi al-Hanafi, Yanabi‘ al-Mawaddah, hlm. 441, meriwayatkan bahawa Nabi Saw. telah menetapkan para imam dua belas. al-Bukhari, Sahih, iv, hlm. 120. Muslim, Sahih, ii, hlm. 81, meriwayatkan berkenaan dengan dua belas amir/khalifah/lelaki
.
7). Kemudian Umar memerintahkan orang ramai supaya membawa kayu api. Merekapun membawa kayu api, begitu juga dengan Umar. Kemudian kayu api itu diletakkan di sekeliling rumah Ali, Fatimah dan dua anak lelakinya. Kemudian Umar telah menyeru Ali. dan Fatimah. Demi Allah! kami akan mengeluarkan kalian wahai Ali! Oleh itu, hendaklah anda membai‘ah Khalifah Rasulullah
.
Jika tidak, aku akan menyalakan api ke atas anda. Maka Fatimah a.s. berkata: Wahai Umar! Apakah pertalian kami dengan anda? Umar berkata: Bukakan pintu, jika tidak kami akan membakar rumah kalian. Fatimah berkata: Wahai Umar! Tidakkah anda bertakwa kepada Allah, anda ingin memasuki rumahku? Namun Umar enggan pulang. Kemudian dia menyeru untuk mendapatkan api lantas menyalakannya di pintu lantas menolaknya dan terus memasuki rumah. Diapun berhadapan dengan Fatimah a.s Abu al-Fida’, Tarikh, i, hlm. 156. al-Tabari, Tarikh, iii, hlm.156-7.
Fatimah a.s. menjerit dan berkata: Wahai bapaku! Wahai Rasulullah!. Tetapi Umar telah mengangkat pedang yang masih tersarung dan meletakkannya di bahu Fatimah a.s. Fatimah melaung: Wahai bapaku! Maka Umarpun mengangkat cemetinya dan terus memukul bahu Fatimah. Fatimah a.s. menyeru lagi: Wahai Rasulullah! Sejahat-jahat manusia selepas anda wafat adalah Abu Bakr dan Umar
.
            Dalam pada itu, Ali a.s. telah melompat lalu memegang hidung dan tengkuk Umar. Hampir-hampir beliau membunuhnya, namun beliau mengingati kata-kata dan wasiat Rasulullah Saw. Beliaupun berkata: Demi orang yang memuliakan Muhammad dengan kenabian, wahai Ibn Sahhak (Umar)! Sekiranya tidak ada kitab daripada Allah terdahulu dan janji yang dijanjikan oleh Rasulullah Saw. kepadaku, nescaya anda mengetahui bahawa anda tidak akan memasuki rumahku
.
           Umar pun meminta orang ramai supaya memasuki rumah Ali manakala Ali a.s. pula telah menerkam ke arah pedangnya, lantas Qunfudh pulang menemui Abu Bakr kerana takut Ali a.s. akan keluar dengan pedangnya. Ibn Qutaibah, al-Imamah wa al-Siyasah, i, hlm. 14-15. al-Tabari, Tarikh, iii, hlm. 198.
8). Dia mengetahui akan kehebatan Ali a.s. Abu Bakr berkata kepada Qunfudh: Kembalilah kepada Ali dan jika dia tidak keluar, cerobohilah rumahnya. Jika dia enggan, nyalakan api ke atas mereka dan rumah mereka sekali
.
            Lalu Qunfudh al-Mal‘un datang semula. Dia dan para sahabatnya telah memasuki rumah Ali a.s. tanpa izin. Ali a.s. telah menerkam kepada pedangnya tetapi mereka mendahuluinya. Mereka datang berpusu-pusu kepadanya dalam jumlah yang ramai. Meskipun begitu Ali a.s. sempat merampas sebahagian daripada pedang mereka.            Akhirnya mereka mencampakkan tali ke leher Ali a.s. Fatimah a.s. pada masa itu yang berada di sebalik pintu dipukul oleh Qunfudh dengan cemeti lalu jatuh pengsan. Terdapat kesan di bahunya seperti warna hitam akibat daripada pukulan tersebut, la‘natullahi ‘alaihi. Kemudian Qunfudh melalui Ali a.s. yang sedang ‘digari’ dan membawanya ke hadapan Abu Bakr dan Umar yang sedang berdiri sambil memegang pedang di atas kepalanya
.
            Khalid bin al-Walid, Abu Ubaidah bin al-Jarrah, Salim maula Abi Hudhaifah, Mu‘adh bin Jabal, al-Mughirah bin Syu‘bah, Usyad bin Hudhair, Basyir bin S‘ad dan semua orang di sekitar Abu Bakr lengkap dengan senjata
.
            Akupun bertanya kepada Salman: Mereka telah memasuki rumah Fatimah tanpa izinnya? Salman menjawab: Ya. Demi Tuhan! Tidak ada di atasnya penutup (khimar), lalu Fatimah a.s. menyeru bapanya wahai bapaku! wahai Rasulullah! Sejahat-jahat manusia selepas anda meninggal adalah Abu Bakr dan Umar. Kedua-dua mata anda belum memejam dengan rapat dalam kuburan anda. Fatimah a.s. telah menyeru dengan suara yang tinggi. Akupun melihat Abu Bakr dan orang di sekelilingnya menangis melainkan Umar, Khalid dan al-Mughirah bin Syu‘bah. Umar berkata: Kami bukan perempuan kerana fikiran mereka tertumpu kepada perkara tertentu
.
            Salman berkata lagi: Mereka menyerahkan Ali a.s. kepada  Abu Bakr. Ali a.s. berkata: Demi Allah! jika terhunus pedang ditanganku maka kalian mengetahui bahawa kalian tidak akan sampai ke sini selama-lamanya. Demi Tuhan! aku tidak mencela diriku di dalam perjuangan kalian. Sekiranya aku dapat mengumpulkan empat puluh orang lelaki, nescaya aku dapat memecahkan kumpulan kalian. Tetapi Allah melaknati orang yang telah memberi bai‘ah kepadaku kemudian mereka tidak mematuhinya pula.
            Manakala Abu Bakr merenung kepadanya dia melaungkan suaranya: Berikan laluan untuknya. Ali a.s. membalas: Alangkah cepatnya kalian menghina Rasulullah Saw.! Di atas hak dan kedudukan manakah anda menyeru orang ramai supaya memberi bai‘ah kepada anda? Tidakkah anda telah memberi bai‘ah kepadaku kemarin dengan perintah Allah dan Rasul-Nya? Qunfudh la‘natullah, telah memukul Fatimah a.s. dengan cemeti apabila terpisah antaranya dan suaminya. Kemudian menolaknya sambil memukul bahunya. Maka gugurlah janinnya daripada perutnya. Fatimah a.s. sentiasa berada di atas hamparannya sehingga beliau mati syahid.
       Salman berkata: Manakala Ali a.s. dibawa kepada Abu Bakr, Umar memekik: Berilah bai‘ah dan tinggalkan kebatilan-kebatilan ini. Ali a.s berkata kepadanya: Sekiranya aku tidak melakukannya, apakah yang akan kalian lakukan kepadaku? Mereka berkata: Kami akan membunuh anda (naqtulu-ka) dengan penuh kehinaan. Beliau berkata: Jika begitu kalian membunuh seorang hamba Allah dan saudara Rasulullah? Abu Bakr menjawab: Adapun seorang hamba Allah, itu benar namun saudara Rasulullah, kami tidak mengakuinya. Ali berkata: Adakah kalian mengingkari bahawa Rasulullah Saw. telah mempersaudarakanku dengannya
Ibn Hanbal, Fadha’il al-Sahabah, ii, hlm. 617
.
9). Ali a.s. telah tampil di hadapan mereka seraya berkata: Wahai Muslimin, Muhajirin dan Ansar! Aku menyeru kalian dengan nama Allah, adakah kalian telah mendengar Rasulullah Saw. berkata pada Hari Ghadir Khum. Ibn Qutaibah, Kitab al-Ma‘arif, hlm. 251-2. Al-Suyuti, al-Durr al-Manthur, ii, hlm. 298
.
10). QS: AN_NISA, AYAT : 54. Maka sesungguhnya Kami telah mengurniakan keluarga Ibrahim akan al-Kitab dan al-Hikmah dan Kami kurniakan kepada mereka kerajaan yang besar”. Maka Al-Kitab adalah al-Nubuwwah(kenabian), al-Hikmah adalah al-Sunnah dan
Al-Mulk adalah al-khilafah. Dan kamilah keluarga Ibrahim. Al-Qunduzi al-Hanafi, Yanabi‘ al-Mawaddah, hlm. 120-1
.

Nabi Muhammad saww Adalah Penentu Para Imam Mazhab Syi’ah

Tapi cukuplah bagi kita sebagai bukti bahwa Ahlussunnah wal Jama’ah mengakui jumlah para Imam yang ke-12 itu, dan tidak terwujud para Imam itu selain ‘Ali dan anak-anaknya yang telah disucikan.
Seorang peneliti tidak akan dapat meragukan pelajaran sejarah Nabi saww dan pengetahuan sejarah Islam, bahwa Nabi saww telah menentukan para Imam yang ke dua belas (12 Imam as. ) dan beliau telah menetapkan mereka sebagai khalifah-khalifah setelahnya dan menjadi penerima wasiat di tengah umatnya. Telah disebutkan jumlah mereka dalam hadis-hadis shahih Ahlussunnah bahwa mereka itu adalah dua belas orang semuanya dari Quraisy, dan hal itu telah diriwayatkan oleh Bukhari dan Muslim serta lainnya. Sebagaimana dalam Sunni telah menyebutkan nama-nama mereka penjelasan Nabi Muhammad saww, bahwa yang pertama adalah ‘Ali bin Abi Thalib dan setelahnya ialah putranya yakni al-Hasan as,kemudian saudaranya al-Husein as, sedang yang terakhir ialah al-Mahdi. Sebagaimana tersebut dalam hadis berikut ini : Shahibu Yanabi’ al-Mawaddah telah meriwayatkan dalam kitabnya, dia berkata, “Seorang Yahudi disebut al-A’tal datang kepada Nabi Muhammad saww, dan ia berkata, “Hai Muhammad, saya menayakan kepadamu perkara-perkara yang telah terdetak dalam dadaku semenjak beberapa waktu, jika engkau dapat menjawabnya niscaya saya akan menyatakan masuk Islam di tanganmu.’Beliau menjawab, ‘Tanyalah! hai Aba Ammarah, maka ia menanyakan beberapa perkara yang sijawab oleh Nabi saww dan ia membenarkan, kemudian ia menanyakan, ‘Beritahukanlah padaku tentang penerimaan wasiatmu, siapakah ia itu? karena tidak seorang Nabi pun kecuali ia mempunyai seorang penerima wasiat, dan sesungguhnya Nabi kami Musa bin Imran telah berwasiat kepada Yusa’ bin Nun.’ Maka beliau bersabda, ‘Sesungguhnya penerima wasiatku adalah ‘Ali bin Abi Thalib dan setelahnya adalah kedua cucuku al-Hasan dan al-Husein kemudian beliau menyebutkan sembilan Imam dari tulang sulbi al-Husein. ‘Lalu ia berkata, ‘Ya Muhammad, sebutkanlah nama-nama mereka kepadaku!’ Beliau bersabda, “Bila al-Husein telah berlalu maka diganti oleh anaknya “Ali, bila ‘Ali telah berlalu maka diganti anaknya Muhammad, bila Muhammad berlalu maka diganti anaknya Ja’far, Musa, ‘Ali, Muhammad, ‘Ali, Hasan,al Hujjah Muhammad al-Mahdi as, maka itu semuanya adalah dua belas orang Imam.’ Kemudian orang Yahudi itu pun masuk Islam dan ia memuji Aallah SWT karena petunjuk-Nya.”(1)
.
Seandainya kita mau membuka lembaran kitab-kitab Syi’ah dan apa yang terkandung di dalamnya, dari hal kebenaran khusususnya tentang masalah ini niscaya kita akan mendapatkan lebih banyak dari itu. Tapi cukuplah bagi kita sebagai bukti bahwa Ahlussunnah wal Jama’ah mengakui jumlah para Imam yang ke-12 itu, dan tidak terwujud para Imam itu selain ‘Ali dan anak-anaknya yang telah disucikan. Dan yang dapat menambahkan kayakinan bagi kita ialah, bahwa Imam yang ke-12 dari Ahlulbait itu tidak pernah belajar pada satu orang pun dari para ulama umat ini, tidak ada yang meriwayatkan pada kita baik para ahli tarikh maupun ahli hadis dan sejarawan, bahwa salah seorang Imam dari Ahlulbait itu mendapatkan ilmunya dari sebagian sahabat atau tabi’in sebagaimana halnya para ulama umat dan para imam mereka.  Sebagaimana Abu Hanifah belajar kepada Imam Ja’far ash -Shadiq dan Malik belajar kepada Abu Hanifah sedang Syafi’i mendapat ilmu dari Malik dan ia mengambil darinya, begitu pula Ahmad bin Hanbal. Adapun para imam Ahlulbait maka ilmu mereka adalah merupakan pemberian dari Allah SWT yang mereka mewarisi dari Bapak yang berasal dari datuk mereka, mereka itulah yang diistimewakan oleh Allah SWT dengan firmannya:“Kemudian kami mewariskan kitab pada orang-orang yang telah kami pilih dari antara hamba-hamba Kami.”(QS.Fathir:32) Imam Ja’far ash-Shadiq pernah menyatakan tentang hakikat tersebut sekali waktu dengan ungkapannya, “Sungguh mengherankan orang-orang itu, mereka mengatakan bahwa mereka mengambil ilmu seluruhnya dari Rasulullah saww dan mengamalkannya serta mendapat petunjuk ! Kemudian mereka mengatakan bahwa kami Ahlulbait tidak mengambil ilmu beliau dan tidak mendapat petunjuk, padahal kami adalah keluarga dan keturunan beliau, di rumah kamilah wahyu itu diturunkan dan dari sisi kami ilmu itu keluar kepada manusia, apakah Anda menganggap mereka berilmu dan mendapat petunjuk sedangkan kami bodoh dan tersesat…?”
.
Ya, bagaimana Imam ash-Shadiq tidak mengherankan mereka itu yang mendakwahkan diri telah mengambil ilmu dari Rasulullah saww, padahal mereka memusuhi Ahlulbait beliau dan pintu ilmunya yang melalui dirinya ilmu itu diberikan, bagaimana tidak mengherankan penempatan nama Ahlussunnah, padahal mereka sendiri penentang sunah itu. Dan bila Syi’ah sebagaimana telah disaksikan oleh sejarah, mereka itu mengistimewakan ‘Ali dan membelanya serta mereka berdiri tegak menentang musuhnya, memerangi orang yang memeranginya, dan damai dengan orang yang damai dengannya dan mereka telah mengambil seluruh ilmu darinya. Maka Ahulussunnah wal Jama’ah itu tidaklah mengikuti dan ingin membinasakannya, dan mereka telah meneruskan sikap itu terhadap anak keturunan setelahnya dengan pembunuhan, penjara, dan pengusiran. Mereka telah bertentangan dengannya dalam kebanyakan hukum dengan dasar mengikuti para pendakwah ilmu pengetahuan yang mereka itu saling berselisih sesuai dengan pendapat dan ijtihad mereka dalam perkara hukum Allah, lalu mereka menggantikannya sesuai dengan hawa nafsu dan kepentingan yang mereka tuju. Dan bagaimana kita sekarang tidak heran terhadap orang-orang yang mendakwahkan mengikuti sunah Nabi saww, dan menyetakan sendiri telah meninggalkan sunah Nabi saww karena ia telah menjadi Syi’ah bagi Syi’ah, (2)
.
bukanlah ini merupakan hal yang mengherankan? Bagaimana kita tidak heran terhadap orang-orang yang mendakwahkan diri sebagai Ahlussunnah wal Jama’ah, sedang mereka merupakan kelompok yang banyak, seperti pengikut Maliki, Hanafi, Syafi’i dan Hambali yang mereka itu saling berselisih sebagian dengan lainnya dala hukum-hukum fiqih dan menganggap bahwa perselisihan itu adalah merupakan suatu rahmat bagi mereka, sehingga dengan demikian agama Allah SWT menjadi lampiasan hawa nafsu dan pendapat serta sasaran selera diri mereka. Memang benarlah, bahwa mereka adalah kelompok terbanyak yang saling berpecah-belah dalam hukum Allah SWT dan Rasul-Nya, tetapi mereka bersatu dan bersepakat dalam mengesakan kekhalifahan Saqifah yang durhaka dan bersepakat dalam meninggalkan dan menjauhkan keluarga Nabi saww, yang Suci.  Bagaimana kita tidak heran terhadap mereka itu yang membanggakan diri sebagai Ahlussunnah, padahal mereka telah meninggalkan yang berharga yakni Kitabullah dan keluarga Rasul betapapun mereka sendiri telah meriwayatkan hadis tersebut dan menshahihkannya…? Sesungguhnya mereka itu tidak berpegang baik pada Al-Qur’an maupun pada keluarga Rasul, sebab dengan meninggalkan keluarga Rasul yang suci itu berarti mereka telah meninggalkan Al-Qur’an, karena hadis yang mulia menetapkannya bahwa Al-Qur’an dan keluarga Rasul itu tidak pernah berpisah selama-lamanya, sebagaimana Rasulullah telah menyatakan hal itu dengan sabdanya: “Tuhan Yang Maha Halus lagi Maha Sadar telah memberitahukan padaku bahwa keduanya yakni Aal-Qur’an dan keluarga Rasul tidak akan pernah berpisah sehingga menemui aku di telaga surga.”(3)
.
Dan bagaimana kita tidak heran kepada kaum yang mendakwahkan diri sebagai Ahlussunnah padahal mereka bersikap menentang terhadap apa yang telah ditetapkan dalam kitab shahih mereka dari hal perbuatan Nabi saww dan perintahnya serta larangannya.(4)
.
Adapun bila kita meyakini dan membenarkan hadis, “aku tinggalkan pada kalian Kitabullah dan sunahku, selama kalian berpegang pada keduanya niscaya kalian tidak akan sesat selama-lamanya.” Sebagaimana yang telah ditetapkan bagi sebagian Ahlussunnah sekarang ini, maka keheranan itu akan menjadi lebih besar dan kecelakaan itu akan lebih jelas. Karena justru para tokoh mereka dan imam mereka itulah orang-orang yang telah membakar sunah yang telah ditinggalkan Rasulullah saww di kalangan mereka, dan telah mencegah periwayatannya dan penulisannya sebagaimana yang telah kita ketahui dalam pembahasan terdahulu. Umar bin khatab sendiri dengan terang-terangan telah menyatakan ucapan, “Cukup bagi kami Kitabullah,” itu adalah merupakan penolakan yang nyata terhadap Rasulullah saww, sedangkan orang yang menolak Rasulullah berarti menolak Allah SWT sebagaimana hal itu tak bisa disembunyikan lagi. Ucapan Umar bin Khathab tersebut telah diriwayatkan oleh seluruh hadis-hadis shahih Ahlussunnah termasuk di dalamnya Bukhari dan Muslim. Apabila Nabi saww telah bersabda, “Aku telah tinggalkan pada kalian Kitabullah dan sunahku, dan kami tidak membutuhkan sunahmu, dan bila Umar telah berkata dihadapan Nabi saww, “Cukup bagi kami Kitabullah, maka sesungguhnya Abu Bakar telah menguatkan untuk mewujudkan pandangan temannya itu lalu ia menyatakan setelah menjadi Khalifah: Janganlah kalian meriwayatkan suatu hadis dari Rasulullah saww, maka jika seseorang bertanya pada kalian, katakanlah di antara mereka kita dan kalian ada Kitabullah, maka halalkanlah apa yang telah dihalalkannya dan haramkanlah apa yang telah diharamkan. (5)
.
Bagaimana kita tidak heran terhadap kaum yang telah meninggalkan sunah Nabi saww mereka dan membelakanginya lalu mereka menggantikan kedudukannya dengan suatu bid’ah yang mereka perbuat yang mana tidak diizinkan oleh Allah SWT, kemudian mereka menamakan diri dan pengikutnya dengan Ahlussunnah wal Jama’ah…? Tetapi keheranan tersebut akan musnah ketika kita katahui bahwa Abu Bakar, Umar, dan Utsman sebenarnya tidak mengenal pemberian nama tersebut selama-lamanya. Inilah Abu Bakar yang telah menyatakan: Jika kalian membebani aku dengan sunah Nabi saww, niscaya aku tidak akan mampu. (6).
Bagaimana mungkin Abu Bakar tidak mampu menjalankan sunah Nabi saww? Apakah sunah beliau itu suatu perkara yang mustahil dilaksanakan, sehingga Abu bakar tidak mampu? Bagaimana Ahlussunnah bisa mendakwahkan diri berpegang padanya jika tokoh mereka yang pertama dan pembina mazhab mereka itu tidak mampu melaksanakan sunah? Bukankah Allah SWT menyatakan, “Pada diri Rasulullah suatu tauladan yang baik bagi kalian .” (QS. al-Ahzab:21)
.
dan firman-Nya, “Allah tidak membebani seseorang kecuali semampunya.” (QS. at-Thalaq:7) Dan juga firman-Nya, “Dan tidak menjadikan suatu kesulitan bagi kalian dalam agama.” (QS. al-Haj :78)
.
Apakah Abu Bakar dan temannya Umar menganggap bahwa Rasulullah telah menciptakan suatu agama yang bukan diturunkan oleh Allah SWT, lalu beliau memerintah kaum Muslim ini dengan sesuatu yang tak terangkat dan membebani mereka dengan kesuliatan? Hal itu tidak mungkin, bahkan yang sering beliau katakan yakni, “Gembirakanlah dan jangan jadikan mereka lari, mudahkanlah dan jangan kalian mempersulit, sesungguhnya Allah SWT telah memberi kalian keringanan maka jangan kalian memberatkan diri kalian sendiri.” Tetapi pengakuan Abu Bakar bahwa ia tidak mampu melaksanakan sunah Nabi saww itu adalah menguatkan apa yang menjadi pendapat kami bahwa ia telah melakukan suatu bid’ah yang mampu ia laksanakan sesuai dengan keinginannya dan sejalan dengan politik yang ia kuasai. Dan mungkin Umar bin Khathab berpandangan yang lain, bahwa hukum-hukum Al-Qur’an dan sunah itu tak mampu dilaksanakan, lalu ia sengaja meninggalkan shalat ketika ia junub sedangkan air tidak didapatinya dan ia berfatwa demikian di saat kekhalifahannya, sedang orang khusus dan yang umum telah mengetahui hal itu dan seluruh ahli hadis telah meriwayatkan itu darinya. Hal itu dikarenakan Umar adalah orang yang gemar banyak bersetubuh dan dialah yang disinggung oleh firman Allah SWT, “Allah mengetahui bahwa kalian mengkhianati diri kalian lalu Dia mengampuni kalian.” (Qs. al-Baqarah: 187)
.
Ini lantaran ia tidak mampu menahan diri dari bersetubuh di waktu puasa, dan dikarenakan air sangat sedikit maka Umar berpendapat bahwa yang paling mudah ialah meningalkan shalat dan bersantai-santai sampai ia mendapatkan air yang mencukupi untuk mandi, ketika itu baru ia kembali mengerjakan shalat. Adapun Utsman maka ia benar-benar telah mengabaikan sunah Nabi saww sebagaimana yang telah dikenal, sehingga ‘Aisyah mengeluarkan baju Nabi saww dan berkata, “Sungguh Utsman telah menghancurkan sunah Nabi saww sebelum baju beliau sendiri menjadi rusak.” Sehingga ia dicela oleh para sahabat bahwa ia telah menentang sunah Nabi saww, dan sunah Abu Bakar, Umar dan mereka pun membunuhnya lantaran itu. Mengenai Muawiyah, terserah apa yang Anda katakan, tidak mengapa, sesungguhnya ia telah meninggalkan Al-Qur’an dan sunah adalah dariku dan aku darinya, siapa yang mencaci ‘Ali sungguh telah mencaciku dan siapa yang mencaciku sungguh ia telah mencaci Allah SWT,” Kita dapati Muawiyah telah mengarahkan cacian dan kutukan padanya ia belum merasa cukup dengan itu sehingga ia memerintahkan seluruh wali-walinya dan para pegawainya untuk mencaci dan mengutuknya, siapa yang menolak di antara mereka maka ia disingkirkan dan dibunuh. Dan kita telah mengetahui bahwa Muawiyah itu adalah orang yang telah menamakan dirinya dan pengikutnya sebagai Ahlussunnah wal jama’ah dalam rangka menentang penamaan Syi’ah sebagai pengikut kebenaran. Dan sebagian ahli sejarah meriwayatkan bahwa tahun dimana Muawiyah memegang penuh kekuasaan umat Islam, setelah mengadakan perjanjian dengan al-Hasan bin ‘Ali Thalib bin Abi Thalib, maka tahun itu dinamakan tahun jama’ah. Dan keheranan pun akan hilang ketika kita memahami bahwa kata-kata sunah itu tidak dimaksudkan oleh Muawiyah dan pengikutnya kecuali hanyalah pengutukan ‘Ali bin Abi Thalib dari atas mimbar-mimbar Islam pada setiap hari Jumat dan hari Raya. Apabila Ahlussunnah wal Jama’ah itu merupakan rekayasa Muawiyah bin Abi Sofyan maka kita memohon pada Allah SWT agar mematikan kita di dalam bid’ah rafidhi yang telah dibina oleh ‘Ali bin Abi Thalib dan Ahlulbait (salam atas mereka). Anda tidak usah kaget wahai pembaca yang mulia, bila Ahlul bid’ah dan kesesatan itu menjadi Ahlussunnah wal Jama’ah sedang imam-imam yang suci dari Ahlulbait itu menjadi Ahli bid’ah. Inilah al-Allamah Ibnu Khaldun yang termasuk ulama termasyhur dari Ahlussunnah wal Jama’ah, ia menyatakannya dengan tegas setelah ia memerinci mazhab-mazhab jumhur ia mengatakan, “Ahlulbait itu menjadi terasing karena aliran faham yang mereka adakan dan fiqih yang berlainan dan mereka telah membina mazhab mereka atas dasar pencacian sebagian sahabat.” (7))
.
Wahai pembaca, bukankah saya telah katakan dari semula, seandainya Anda berbuat sebaliknya niscaya Anda benar/tepat. Maka jika orang-orang fasik dari kalangan Bani Umayah mereka itu adalah Ahlussunnah dan Ahlulbait itu adalah Ahli bid’ah seperti yang dikatakan Ibnu Khaldun, maka buat Islam ucapan selamat jalan dan buat dunia ucapan selamat datang
.
Foot note
  1. Riwayat al-Qunduzi al-Hanafi dalam kitab Yanabi’ al-Mawaddah, hal. 440, dan Faraid as-Samthain oleh al-Humawaini dengan sanad dari Ibnu Abbas.
  2. Sesuai pernyataan Ibnu Taimiyah untuk meninggalkan sunah Nabi saww bila itu  telah menjadi syi’ar bagi Syi’ah, lihat Minhaj as-Sunnah oleh Ibnu Taimiyah,II, hal.  143, dan Syarh al-Mawahib oleh Zargani,V, hal.13.
  3. Imam Ahmad dalam Musnad-nya, V, hal. 189, dan al-Hakim dalam Mustadark, III, hal. 148 dan ia menyatakan shahih menurut syarat Bukhari Muslim.
  4. Diriwayatkan Bukhari dalam Shahih-nya bahwa Nabi saww melarang shalat tarawih dalam bulan Ramadhan secara jama’ah dengan sabdanya, “Shalatlah wahai manusia di rumah-rumah kalian, sesungguhnya seutama-seutama shalat seseorang adalah di rumahnya selain shalat fardu.” Tetapi Ahlussunnah mengabaikan larangan Nabi saww dan mereka mengikuti bid’ah Umar bin Khathab.
  5. Tadzkirat al-Huffadz oleh Dzahabi, I, hal. 3.
  6. Lihat Musnad Ahmad bin Hanbal, I, hal. 4
  7. Muqaddaimah Ibnu Khaldun, hal. 494 dalam fasal Ilmu Fiqih
  8. .

.

Kembali Kepada Al Quran dan Ahlul Bait

Islam adalah keduanya (Al Quran dan Ahlul Bait) yang tidak akan terpisah hingga akhir zaman, hingga kehadiran Ahlul Bait Rasulullah yang terakhir, Imam Mahdi afs yang dinanti-natikan. Ahlul Bait adalah madrasah yang paling komplit yang mengandung berbagai khazanah ke- Islaman. Madrasah ini telah terbukti menghasilkan kader-kader yang mumpuni dan telah mempersembahkan karya-karya cemerlang bagi kehidupan umat manusia.
Sepanjang sejarah perjalanan umat manusia, polemik dan perbedaan pendapat telah menjadi keniscayaan tersendiri yang tak terelakkan. Adanya paradigma (cara pandang) yang berbeda pada umat manusia adalah konklusi dari dua jalan (kebajikan dan kejahatan) yang telah diilhamkan Allah SWT dalam diri setiap manusia (baca Qs. 90:10)
.
Oleh karenanya, keberadaan tolok ukur kebenaran yang menjadi rujukan semua pihak adalah suatu keniscayaan pula, yang eksistensinya bagian dari hikmah Ilahi. Allah SWT telah menurunkan kitab pedoman yang merupakan tolok ukur kebenaran dan menjadi penengah untuk menyelesaikan berbagai hal yang diperselisihkan umat manusia
.
Allah SWT berfirman: “Manusia itu (dahulunya) satu umat. Lalu Allah mengutus para Nabi (untuk) menyampaikan kabar gembira dan peringatan. Dan diturunkan-Nya bersama mereka kitab yang mengandung kebenaran, untuk memberi keputusan di antara manusia tentang perkara yang mereka perselisihkan.” (Qs. Al-Baqarah : 213)
.
Ayat ini menjelaskan bahwa manusia tanpa bimbingan dan petunjuk Ilahi akan berpecah belah dan bergolong-golongan. Penggalan selanjutnya pada ayat yang sama menjelaskan pula, bahwa kedengkian dan memperturutkan hawa nafsulah yang menyebabkan manusia terlibat dalam perselisihan dan perpecahan.
Kebijaksanaan Ilahilah yang kemudian menurunkan sang Penengah (para nabi as) yang membawa kitab-kitab yang menerangi. Kitab-kitab Ilahiah terutama Al Quran memberikan petunjuk dan arahan yang jelas tentang kebenaran yang seharusnya ditempuh umat manusia.
Namun hawa nafsu, kedengkian, kedurhakaan dan juga kebodohan telah menjerumuskan manusia jauh berpaling dari mata air jernih kebenaran.
Puluhan ribu nabi telah diutus sepanjang sejarah hidup manusia di segala penjuru dunia. Umat Islam meyakini mata rantai kenabian bermula dari Nabi Adam as dan berakhir di tangan Muhammad SAW dan tidak ada lagi nabi sesudahnya
.
Ditutupnya kenabian hanya bisa sesuai dengan hikmah dan falsafah diutusnya para nabi bila syariat samawi yang terakhir tersebut memenuhi seluruh kebutuhan umat manusia, di setiap masa dan di setiap tempat. Al Quran sebagai kitab samawi terakhir telah dijamin oleh Allah SWT keabadian dan keutuhannya dari berbagai penyimpangan hingga akhir masa.
Akan tetapi secara zahir Al Quran tidak menjelaskan hukum-hukum dan ajaran Islam secara mendetail. Oleh karenanya penjelasan perincian hukum menjadi tanggung jawab nabi untuk menerangkannya kepada seluruh umatnya.Sewaktu Nabi Muhammad SAW masih hidup tanggung jawab itu berada dipundaknya. Karena itu hadits-hadits Nabi Muhammad SAW menjadi hujah dan sumber autentik ajaran Islam. Namun apakah semasa hidupnya, Rasulullah SAW telah menjelaskan seluruh hukum dan syariat Islam kepada seluruh umat?
.
Kalau tidak semua, siapa yang bertanggung jawab untuk menjelaskannya? Siapa pula yang bertanggung jawab menengahi silang sengketa sekiranya terjadi penafsiran yang berbeda tentang ayat-ayat Al Quran dalam tubuh umat Islam?
Saya sulit menerima jika dikatakan tanggung jawab penjelasan syariat Islam pasca Rasul jatuh ke tangan para sahabat. Sementara untuk contoh sederhana sahabat sendiri berbeda pendapat bagaimana cara Rasululullah melakukan wudhu dan salat yang benar, padahal Rasul mempraktikkan wudhu dan salat bertahun-tahun di hadapan mereka
.
Untuk persoalan wudhu saja mereka menukilkan pendapat yang berbeda-beda, karenanya pada masalah yang lebih rumit sangat mungkin terjadi penukilan yang keliru. Ataupun tanggung jawab penafsiran Al Quran jatuh kepada keempat imam mazhab yang untuk sekadar menafsirkan apa yang dimaksud debu pada surah Al-Maidah ayat 6 saja sulit menemukan kesepakatan
.
Kata mazhab Syafi’i debu meliputi pasir dan tanah, tanah saja kata Hanbali; tanah, pasir, batuan, salju dan logam kata Maliki; tanah, pasir dan batuan kata Hanafi (al-Mughniyah, 1960; Al-Jaziri, 1986)
.
Petunjuk Umat
Islam hanya dapat ditawarkan sebagai agama yang sempurna, yang dapat memenuhi segala kebutuhan manusia jika di dalam agama itu sendiri tidak terdapat perselisihan dan perpecahan. Karenanya, hikmah Ilahi meniscayakan adanya orang-orang yang memiliki kriteria seperti yang dimiliki Nabi Muhammad SAW untuk memberikan bimbingan kepada umat manusia di setiap masa tentunya selain syariat
.
Ilmu yang mereka miliki tidak terbatas dengan apa yang pernah disampaikan Nabi Muhammad SAW (sebagaimana maklum Nabi tidak sempat menjelaskan semua tentang syariat Islam) namun juga memiliki potensi mendapatkan ilmu langsung dari Allah SWT ataupun melalui perantara sebagaimana ilham yang diterima Siti Maryam dan ibu nabi Musa as (Lihat Qs. Ali-Imran : 42, Thaha:38)
.
Mereka menguasai ilmu Al Quran sebagaimana penguasaan nabi Muhammad SAW sehingga ucapan-ucapan merekapun merupakan hujjah dan sumber autentik ajaran Islam. Masalah ini berkaitan dengan Al Quran sebagai mukjizat, berkaitan dengan kedalaman dan ketinggian Al Quran, sehingga hukumnya membutuhkan penafsir dan pengulas
.
Al Quran adalah petunjuk untuk seluruh ummat manusia sampai akhir zaman karenanya akan selalu berlaku dan akan selalu ada yang akan menjelaskannya sesuai dengan pengetahuan Ilahi. “Sungguh, Kami telah mendatangkan kitab (Al Quran) kepada mereka, yang Kami jelaskan atas dasar pengetahuan, sebagai petunjuk dan rahmat bagi orang-orang yang beriman.” (Qs. Al-A’raf :52)
.
Pada ayat lain, Allah SWT berfirman, “Dan Kami tidak menurunkan kepadamu al-Kitab ini, melainkan agar kamu dapat menjelaskan kepada mereka apa yang mereka perselisihkan itu dan menjadi petunjuk dan rahmat bagi kaum yang beriman. ” (Qs. An-Nahl : 64).
Dengan pemahaman seperti ini maka jelaslah maksud dari penggalan hadits Rasulullah, Kutinggalkan bagi kalian dua hal yang berharga, Al Quran dan Ahlul Baitku. (HR Muslim). Bahwa keduanya Al Quran dan Ahlul Bait adalah dua hal yang tak terpisahkan hingga hari kiamat, memisahkan satu sama lain akibatnya adalah kesesatan dan di luar dari koridor ajaran Islam itu sendiri
.
Penyimpangan
Rasul menyebut keduanya (Al Quran dan Ahlul Baitnya) sebagai Tsaqalain yakni sesuatu yang sangat berharga. Keduanya saling melengkapi dan tidak dapat dipisahkan. Penerus nabi adalah orang-orang yang tahu interpretasi ayat-ayat Al Quran sesuai dengan makna sejatinya, sesuai dengan karakter esensial Islam, sebagaimana yang dikehendaki Allah SWT
.
Rasulullah menjamin bahwa siapapun yang bersungguh-sungguh dan berpegang pada kedua tsaqal ini, maka tidak akan pernah mengalami kesesatan. Kemunduran dan penyimpangan kaum Muslimin terjadi ketika mencoba memisahkan kedua tsaqal ini
.
Islam adalah keduanya (Al Quran dan Ahlul Bait) yang tidak akan terpisah hingga akhir zaman, hingga kehadiran Ahlul Bait Rasulullah yang terakhir, Imam Mahdi afs yang dinanti-natikan. Ahlul Bait adalah madrasah yang paling komplit yang mengandung berbagai khazanah ke- Islaman. Madrasah ini telah terbukti menghasilkan kader-kader yang mumpuni dan telah mempersembahkan karya-karya cemerlang bagi kehidupan umat manusia.
Imam Ja’far Shadiq (fiqh), Jalaluddin Rumi (tasawuf), Ibnu Sina (kedokteran), Mullah Sadra (Filsafat), Allamah Taba’tabai (tafsir) dan Imam Khomeini (politik), sebagian kecil orang-orang besar yang terlahir dari madrasah ini.

Al Quran Menyatakan Umat Khianati Ali Pasca Wafat Nabi SAW (Qs. Al An’am ayat 65-67)

 

Oleh : Ustad Husain Ardilla

.

UMAT  KHiANATi  Ali  PASCA  NABi  SAW WAFAT

.

Qs. Al An’am ayat 65-67

Qs. 6:65. Katakanlah (Muhammad), “Dialah yang berkuasa mengirimkan azab kepadamu, dari atas atau dari bawah kakimu atau Dia mencampurkan kamu dalam golongan golongan (yang saling bertentangan) dan merasakan kepada sebagian kamu keganasan sebagian yang lain.” Perhatikanlah bagaimana Kami menjelaskan berulang ulang tanda tanda (kekuasaan Kami) agar mereka memahami (nya)

Qs. 6:66. Dan kaummu mendustakannya (azab) padahal (azab) itu benar adanya. Katakanlah (Muhammad), “Aku ini bukanlah penanggung jawab kamu”

Qs. 6:67. Setiap berita (yang dibawa oleh Rasul) ada (waktu) terjadinya dan kelak kamu akan mengetahui

Dikutip dari  “AL HiDAYAH ALQURAN TAFSiR PERKATA TAJWID KODE ANGKA PENERBIT KALiM”  yang disahkan DEPAG, halaman 136 :

Asbabun Nuzul Qs.6 : 65-67 : Zaid bin Aslam mengatakan bahwa Rasulullah SAW bersabda  kepada para sahabat, “Setelah kepergianku, janganlah kalian kembali menjadi kafir dengan saling membunuh diantara kalian”. Mereka berkata, “Kami bersaksi bahwa tidak ada Tuhan selain Allah dan sesungguhnya engkau adalah Rasul Nya. “Sebagian yang lain berkata, “ini tidak akan pernah terjadi untuk selamanya, yaitu saling membunuh diantara kita, sementara kita semua adalah muslim.” Maka turunlah ketiga ayat ini (HR. Ibnu Abi Hatim)

Wahai para pembaca…

Qs. Asy Syu’ara; ayat 205-207

Qs.26 : 205  : Maka bagaimana pendapatmu jika kepada mereka kami berikan kenikmatan hidup beberapa tahun,

Qs.26 : 206  : Kemudian datang kepada mereka azab yang diancamkan kepada mereka,

Qs.26 : 207  : Niscaya tidak berguna bagi mereka kenikmatan yang mereka rasakan

Dikutip dari  “AL HiDAYAH ALQURAN TAFSiR PERKATA TAJWID KODE ANGKA PENERBIT KALiM”  yang disahkan DEPAG, halaman  376 :

Asbabun Nuzul Qs.26 : 205-207 : Menurut Abu Jahdham, ketiga ayat ini diturunkan berkenaan dengan Rasulullah yang suatu ketika terlihat bingung dan gelisah. Para sahabat menanyakan hal itu. “Aku bermimpi, setelah aku wafat kelak, aku melihat musuhku yang ternyata adalah berasal dari umatku sendiri,” jawab Rasulullah (HR.ibnu Abi Hatim)

Wahai para pembaca…

DUA SUMBER PERBEDAAN AGAMA SAMAWI

 Kepemimpinan Penggantinya di khianati oleh sebagian umatnya

Golongan Suni :

                    Karena tidak mengakui pengangkatan Ali bin Abi Thalib sebagai Penerus/Pengganti Nabi Muhammad SAW dengan kedudukan Imam (pemimpin) bagi umat Islam, maka Golongan Suni berpandangan tidak ada perbuatan penghianatan terhadap kepemimpinan Penerus/-Pengganti Nabi Muhammad saw.

Pengangkatan Abu Bakar sebagai Khalifah setelah wafatnya Nabi Muhammad saw adalah sah karena didasarkan pada kesepakatan (musyawarah) umat Islam yang dilaksanakan di Saqifah, Balai Pertemuan Bani Saidah.

Golongan Syi’ah:

Pengangkatan Ali bin Abi Thalib sebagai Imam (pemimpin) umat Islam (setelah Nabi SAW) oleh Nabi Muhammad SAW sendiri di Gadhir Khum adalah merupakan ketetapan Nabi SAW yang wajib di taati. Jika kemudian segelintir umat Islam yang berkumpul di Balai Pertemuan Saqifah Bani Saidah, memilih Abu Bakar sebagai Khalifah pertama setelah wafatnya Nabi SAW, maka perbuatan itu merupakan pembangkangan terhadap Ketetapan Nabi Muhammad SAW serta merupakan pengkhianatan terhadap Ali bin Abi Thalib yang telah diangkat sebagai Pemimpin/Imam Umat Islam.

(Lihat Peristiwa Penolakan Bani Israel terhadap Pengangkatan Nabi Harun as sebagai Pengganti/Penerus Nabi Musa as pada Kemah Pertemuan Bani Korah)

Dengan demikian jika berpegang pada pandangan Golongan Suni, maka Nabi Muhammad SAW tidak memenuhi Aspek  persamaan dengan Nabi Musa as, karena tidak ada perbuatan penghianatan terhadap Pemimpin/Imam, sebab memang Beliau SAW tidak pernah mengangkat anggota keluarganya (Ali bin Abi Thalib as) sebagai Pemimpin/Imam umat Islam sepeninggal Nabi Muhammad SAW.

Kendati tak henti-hentinya Nabi saw. menasihati para sahabat dan umat Islam akan besarnya hak Ahlulbait as. atas mereka… kendati pesan demi pesan telah beliau sampaikan agar umat bersikap baik, medukung, membela dan menerima kepmipminan Ahlulbait as., namun pasan-pasan dan wasiat-wasiay Nabi saw. itu sepertinya tidak mendapat sambutan semestinya… mereka makin memebenci Imam Ali dan Ahlulbait Nabi saw., sampai-sampai seakan, andai Nabi saw. memerintahkan mereka untuk membencinya niscaya apa yang sudah mereka lakukan sudah melebihi dari cukup… Andai Nabi saw. memerintah mereka untuk mengkhianatinya niscaya pengkhianatan yang mereka lakukan sudah melebihi apa yang beliau perintahkan… mereka lebih memilih jalan pengkhianatan ketimbang kesetiaan… lebih menyukai jalan kebencian ketimbang kecintaan….

Kini Umat Mengkhianati Sang Imam as.!

Pengkhiatan itu begitu menyakitkan…. Karena ia akan membawa kesengsaraan dunia akhirat …. Pengkhianatan yang akan menghalangi sang Imam meberikan bimbingan keselamatan dan menghindarkan mereka dari kebinasaan… Karenanya, Imam Ali as. berulang kali mengatakan:

إنّه ممّا عهد إليّ النبي (صلى الله عليه وآله وسلم) أنّ الاُمّة ستغدر بي بعده

“Termasuk yang dijanjikan Nabi kepadaku bahwa umat akan mengkhianatiku sepeninggal beliau.”

Sumber Hadis:

Hadis ini telah diriwayatkan dan dishahihkan al Hakim dan adz Dzahabi. Ia berkata:

صحيح الاسناد

“Hadis ini sahih sanadnya.”

Adz Dzahabi pun menshahihkannya. Ia berkata:

صحيح

“Hadis ini shahih.” [1]

Sebagaimana juga diriwayatkan oleh Ibnu Abi Syaibah, al Bazzâr, ad Dâruquthni, al Khathib al Baghdâdi, al Baihaqi dkk.

Nabi saw. Mengabarkan Bahwa Umat Akan Menuangkan Kedengkian Mereka Kepada Imam Ali as.

Pengkhianatan itu akan mereka tuangkan dalam bentuk dendam kusumat terlaknat ke atas Imam Ali as. dan Ahlulbait Nabi saw. sepeninggal beliau.

Demikianlah, mereka yang memendam dendam kusumat dan kebencian kepada Nabi saw. akan menuangkannya kepada Imam Ali as., dan puncaknya akan mereka lakukan sepeninggal Nabi saw.

Kenyataan itu telah diberitakan Nabi saw. kepada Ali as. Para ulama meriwayatkan banyak hadis tentangnya, di antaranya adalah hadis di bawah ini:

Imam Ali as. berkata:

بينا رسول الله (صلى الله عليه وسلم) آخذ بيدي ونحن نمشي في بعض سكك المدينة، إذ أتينا على حديقة، فقلت: يا رسول الله ما أحسنها من حديقة ! فقال: إنّ لك في الجنّة أحسن منها، ثمّ مررنا بأُخرى فقلت: يا رسول الله ما أحسنها من حديقة ! قال: لك في الجنّة أحسن منها، حتّى مررنا بسبع حدائق، كلّ ذلك أقول ما أحسنها ويقول: لك في الجنّة أحسن منها، فلمّا خلا لي الطريق اعتنقني ثمّ أجهش باكياً، قلت: يا رسول الله ما يبكيك ؟ قال: ضغائن في صدور أقوام لا يبدونها لك إلاّ من بعدي، قال: قلت يا رسول الله في سلامة من ديني ؟ قال: في سلامة من دينك

“Ketika Rasulullah saw. memegang tanganku, ketika itu kami sedang berjalan-jalan di sebagian kampong kota Madinah, kami mendatangi sebuah kebun, aku berkata, ‘Wahai Rasulullah alangkah indahnya kebun ini!’ Maka beliau bersabda, ‘Untukmu di surga lebih indah darinya.’ Kemudian kami melewati tujuh kebun, dan setiap kali aku mengatakannya, ‘Alangkah indahnya’ dan nabi pun bersabda, ‘Untukmu di surga lebih indah darinya.’ Maka ketika kami berda di tempat yang sepi, Nabi saw. memelukku dan sepontan menangis. Aku berkata, ‘Wahai Rrasulullah, gerangan apa yang menyebabkan Anda menangis?’ Beliau menjawab, ‘Kedengkian-kedengkian yang ada di dada-dada sebagian kaum yang tidak akan mereka tampakkan kecuali setelah kematianku.’ Aku berkata, ‘Apakah dalam keselamatan dalam agamaku?’ Beliau menjawab, ‘Ya. Dalam keselamatan agamamu.’”

Sumber Hadis:

Hadis ini diriwayatkan oleh Abu Ya’la, al Bazzâr dengan sanad shahih, al Hakim dan adz Dzahabi dan mereka menshahihkannya,[2] Ibnu Hibbân dkk. [3]

Ia juga disebutkan oleh asy Syablanji dalam kitab Nûr al Abshârnya:88

Jadi jelaslah bagi kita apa yang sedang dialami oleh Imam Ali as. dari sebagian umat ini!

Imam Ali as. Mengeluhkan Pengkhianat Sahabat Dari Suku Quraisy dan Para Pendukungnya

Dalam banyak pernyataannya, Imam Ali as. mengeluhkan kedengkian, kejahatan dan pengkhianatan tokoh-tokoh suku Quraisy terhadap Nabi saw. yang kemudian, ketika mereka tidak mendapatkan jalan untuk meluapkannya kepada beliau saw., mereka meluapkan dendanm kusumat kekafiran dan kemunafikan kepadanya as.

Di bawah ini akan saya sebutkan sebuah kutipan pernyataan beliau as. tersebut.

اللهمّ إنّي أستعديك على قريش، فإنّهم أضمروا لرسولك (صلى الله عليه وآله وسلم) ضروباً من الشر والغدر، فعجزوا عنها، وحُلت بينهم وبينها، فكانت الوجبة بي والدائرة عليّ، اللهمّ احفظ حسناًوحسيناً، ولا تمكّن فجرة قريش منهما ما دمت حيّاً، فإذا توفّيتني فأنت الرقيب عليهم وأنت على كلّ شيء شهيد

“Ya Allah, aku memohon dari Mu agar melawan Quraisy, karena mereka telah memendam bermacam sikpa jahat dan pengkhianatan kepada Rasul-Mu saw., lalu mereka lemah dari meluapkannya, dan Engkau menghalang-halangi mereka darinya, maka dicicipkannya kepadaku dan dialamatkannya ke atasku. Ya Allah peliharalah Hasan dan Husain, jangan Engkau beri kesempatan orang-orang durjana dari Quraisy itu membinasakan keduanya selagi aku masih hidup. Dan jika Engkau telah wafatkan aku, maka Engkau-lah yang mengontrol mereka, dan Engkau Maha Menyaksikan segala sesuatu.”[4]

Coba Anda perhatikan pernyataan Imam Ali as. di atas, bagaimana dendam dan pengkhianatan Quraisy terhadap Nabi saw. akan mereka luapkan kepadanya! Dan di dalamnya juga terdapat penegasan bahwa mereka tidak segan-segan akan menghabisi nyawa bocah-bocah mungil kesayangan Rasulullah saw.; Hasan dan Husain as. yang akan meneruskan garis keturunan kebanian sebagai melampiasan dendam mereka kepada Nabi saw.!

Dalam salah sebuah pidatonya yang lain, Imam Ali as. mempertegas hal tersebut, beliau berkata:

وقال قائل: إنّك يا ابن أبي طالب على هذا الامر لحريص، فقلت: بل أنتم ـ والله ـ أحرص وأبعد، وأنا أخص وأقرب، وإنّما طلبت حقّاً لي وأنتم تحولون بيني وبينه، وتضربون وجهي دونه، فلما قرّعته بالحجة في الملا الحاضرين هبّ كأنه بهت لا يدري ما يجيبني به.

اللهم إني استعديك على قريش ومن أعانهم، فانهم قطعوا رحمي، وصغّروا عظيم منزلتي، وأجمعوا على منازعتي أمراً هو لي، ثم قالوا: ألا إنَّ في الحق أنْ تأخذه وفي الحق أن تتركه .

“Ada seorang berkata, ‘Hai putra Abu, Sesungguhnya engkau rakus terhadap urusan (Kekhalifahan) ini!’ Maka aku berkata, “Demi Allah, kalian-lah yang lebih rakus dan lebih jauh, adapun aku lebih khusus dan lebih dekat. Aku hanya meminta hakku, sedangkan kalian menghalang-halangiku darinya, dan menutup wajahku darinya. Dan ketika aku bungkam dia dengan bukti di hadapan halayak ramai yang hadir, ia terdiam, tidak mengerti apa yang harus ia katakan untuk membantahku.

Ya Allah, aku memohon pertolongan-Mu atas Quraisy dan sesiapa yang membela mereka, karena sesungguhnya mereka telah memutus tali kekerabatanku, menghinakan keagungan kedudukanku dan bersepakat merampas sesuatu yang menjadi hakku. Mereka berkata, ‘Ketahuilah bahwa adalah hak kamu untuk menuntut dan hak kamu pula untuk dibiarkan.”[5]

Coba Anda perhatikan pengkhianatan apa yang mereka lakukan… ketika Imam Ali as. berusaha mengambil kembali hak beliau yang mereka rampas, jusretu mereka menuduhnya rakus dan gila kekuasaan… sementara mereka yang merampas haknya merasa benar dan menjalanlan apa yang seharusnya mereka lakukan! Karenanya, kemudian beliau membungkam mulut khianat mereka dengan hujjah yang tak terbantahkan….


[1] Mustadrak al Hakim,3/140 dan 142.

[2] Al Mustadrak,3/139 hanya saja bagian akhir radaksi hadis ini terpotong, sepertinya ada “tangan-tangan terampil” yang sengaja menyensor hadis di atas.

[3]Teks hadis di atas sesuai dengan yang terdapat Majma’ az Zawâid,9/118.

[4] Syarah Nahjul Balaghhah, 20/298.

[5] Nahjul Balaghah, kuthbah ke.172

saudaraku….

Dialog Ibnu Abbas ra. Dan Sayyidina Umar Seputar Perampasan Hak Imamah Ali as.

Banyak spekulasi yang dipaksakan para ulama Sunni dalam menyikapi apa yang terjadi sesa’at setelah Nabi saw. wafat ketika para sahabat menyingkirkan Imam Ali as. dari hak kepemimpinan tertinggi umat Islam.. Mereka terpaksa mendustakan atau memalingkan ketegasan makna nash-nash penunjukan Imam Ali as. khususnya sabda Nabi saw. di Ghadir Khum, hanya karena satu alasan yaitu jika diterima kenyataan baahwa Nabi saw. telah menunjuk Ali sebagai Imam dan pemimpin tertinggi umat Islam sepeninggal beliau, mana mungkin para sahabat itu sepakat menentangnya?! Itu artinya kita menuduh para sahabat itu sebagai yang fasik karena terang-terangan menentang wasiat Nabi saw.

Tetapi jika kita mau jujur dalam melihat masalah ini, kita akan menyaksikan bahwa telah ada kesepakatan di balik meja antara para pembesar Quraisy (termasuk di antara mereka adalah para tokoh kafir Quraisy yang baru memeluk Islam karena terpaksa setelah kota Mekkah ditaklukkan dan juga sebagian sahabat lama dari suku Quraisy) yang akan berusaha sekuat tenaga untuk menyingkirkan Imam Ali as. dan bahkan siapapun dari suku bani Hasyim (sukunya Nabi saw.) dari tampuk kekuasaan khilafah… mereka hanya akan menggilir khilafah ini pada suku-suku Quraisy selain bani Hasyim…

Dialoq di bawah ini akan menjelaskan kenyataan adanya persekongkolan jahat tokoh-tokoh Quraisy… Dan dokumen ini sangat bernilai mengingat ia memuat pengakuan dari arsitek pembaiatan Saqifah yaitu sayyidina Umar ibn al-Khaththab…. Dan yang juga menentang penulisan wasiat keselamatan abadi yang hendak dituliskan Nabi saw di hari-hari akhir sebelum beliau meninggalkan umat Islam untuk selamanya…

Sayyidina Umar Membongkar Persekongkolan Quraisy Dalam Menyingkirkan Imam Ali as.

.

Ibnu Abil Hadid Al Mu’tazili dalam Syahr Nahjul Balaghah-nya dan Ibnu Al Atsir dalam al Kamil-nya menriwayatkan dialog panjang antara Sayyidinna Umar dan Ibnu Abbas ra. sebagai berikut:

Umar, “Hai Ibnu Abbas, tahukah kamu apa yang mendorong kaum Quraisy menolak kepemimpinan Ahlulbait sepeningal Muhammad?”

Ibnu Abbas, “Maka aku tidak ingin berterus terang dalam menjawab, lalu aku katakan kepada Umar, ‘Kalau saya tidak mengetahuinya, tentu Amirul Mu’minin mengetahuinya.’

Umar, Karena mereka (kaum Quraisy) tidak menyukai berkumpul kenabian dan kekhilafahan pada kalian (Bani Hasyim), sebab kalian akan menjadi congkak dan semena-mena tehadap kaum kalian. Oleh sebab itu kaum Quraisy memilih untuk mereka seorang pemimpin dan langkah itu benar dan sesuai ….. .

Ibnu Abbas“Apakah Amirul Mukminin bersedia menjauhkan dariku amarahnya lalu mendengarkan pembicaraan saya?”

Umar, “Ucapkan terserah kamu!”

Ibnu Abbas“Adapun ucapan Amirul Mukminin bahwa Quraiys membenci (berkumpulnya kenabian dan kekhilafahan pada bani Hasyim), maka sesungguhnya Allah –Ta’ala- telah berfirman :“Yang demikian itu adalah kerena sesungguhnya mereka benci kepada apa yang di turunkan Allah lalu Allah menghapus (pahal-pahala) amal –amal mereka ” (QS:47;9).

Adapun ucapan Anda, ‘Bahwa kami akan congkak. Maka jika kami bakal congkak dikarenakan jabatan khilafah maka sesungguhnya kami akan congkak dikarenakan kekerabatan kami (dengan Nabi saww), akan tetapi kami adalah kaum yang akhlak kami terbelah dari akhlak Rasulullah yang Allah berfirman tentangnya“Dan sesungguhnya kamu berada di atas akhlak(budi pekerti)  yang agung”(QS:68;4) dan Allah berfirman kepadanya: “Dan rendahkanlah dirimu terhadap orang-orang yang mengikutimu,yaitu orang-orang yang beriman “(QS:26;215).

Adapun ucapan Anda bahwa kaum Quraiys memilih …, maka Allah telah berfirman : “Dan Tuhanmu menciptakan apa yang Dia kehendaki dan memilih. Sekali-kali tidak ada pilihan bagi mereka”. (QS:28;68). Dan Anda –wahai Amirul Mukminin- mengetahui sesungguhnya Allah telah memilih dari hambaNya untuk jabatan itu .Dan andai kaum Quraisy berpendapat seperti yang ditetapkan Allah niscaya mereka tepat dan benar .

Umar, Tunggu, hai Ibnu Abbas, memang hati kalian Bani Hasyim enggan kecuali kebencian yang tiada padam dan kedengkian yang tiada berubah terhadap urusan kaum Quraisy.”

Ibnu Abbas, Tenang wahai Amurul Mukminin, jangan Anda menuduh hati Bani Hasyim dengan kedengkian, sebab hati mereka dari hati Rasulullah yang disucikan dari noda, mereka adalah Ahlulbait yang Allah berfirman kepada mereka: “Sesungguhnya Kami berkehendak untuk menghilangkan dari kalian rijs –wahai Ahlul-Bait dan mensucikan kalian sesuci-sucinya” .

Adapun ucapan Anda, “Mereka sakit hati. Maka benar, bagaimana seseorang yang miliknya dirampas dan melihat miliknya di tangan orang lain ia tidak sakit hati?!”

Umar“Adapun kamu hai Ibnu Abbas telah sampai kepada saya ucapanmu yang saya tidak suka memberitahukannya kepadamu, sebab akan menjatuhkan kedudukanmu disisiku.”

Ibnu Abbas“Apa itu wahai Amirul Mukminin, beritahukan kepadaku, kalua ia kebatilan maka orang seperti saya layak menjauhkan kebatilan dari dirinya dan jika ia haq maka kedudukanku disisi Anda tidak sepatutnya akan jatuh.”

Umar“Telah sampai kepadaku bahwa kamu senantiasa mengatakan: Perkara ini di rampas dari kami karena kedengkian (rasa hasut) dan dengan kezaliman.”

Ibnu Abbas, Adapun ucapan Anda ‘karena rasa hasut’, maka sesungguhnya Iblis telah mengahsut Adam sehingga mengeluarkannya dari surga dan kami adalah anak turun Adam yang di hasuti.

Adapun ucaapan Anda ‘dengan kezaliman’, maka sesungguhnya Amirul Mukminin mengatahui pemilik hak ini, siapa dia?

Kemudian Ibnu Abbas berkata, “Wahai Amirul Mukminin, bukankah bangsa Arab berhujjah atas orang ajam (non Arab) dengan kedudukan Rasulullah, dan suku Quraisy berhujjah atas seluruh bangsa Arab dengan kedudukan Rasulullah saww, maka kami lebih berhak terhadap Rasulullah dari seluruh Quraiys.”

Umar, Berdirilah sekarang dan pulanglah kerumahmu!”

Maka Ibnu Abbas berdiri dan ketika ia berjalan Umar memanggilnya, “Hai orang yang sedang berpaling, saya tetap seperti dulu, memelihara hakmu. Lalu Ibnu Abbas menoleh dan berkata, “Sesungguhnya saya punya hak atas Anda, wahai Amirul Mukminin dan atas seluruh kaum Muslimin dengan kedudukan Rasulullah saw., maka barang siapa memeliharanya berarti ia memelihara hak dirinya sendiri dan barang siapa menyia-nyiakannya maka ia menyia-nyiakannya. Kemudian ia berlalu, maka Umar berkata kepada mereka yang duduk bersamanya, “Aduh, Ibnu Abbas, tiada saya melihat ia berdebat dengan seorang kecuali ia mengalahkannya.[1]

.

Analisa Ringkas terhadap Dialoq diatas

Dari dialoq panjang antara Sayyidina Umar; arsitek pembaiatan Saqifah dan Ibnu Abbas ra. salah seorang keluarga besar Bani Hasyim yang dirampas hak kepemipimnanya oleh mereka yang merampasnya dapat Anda saksikan beberapa poin penting, di antaranya:

  • Umar berterus terang bahwa suku Quraisy benci pengaturan Tuhan yang menggabungkan kenabian dan khilafah pada keluarga Muahammad saww.
  • Pengaturan Tuhan mengandung arti menzalimi hak suku Quraisy –selain Bani Hasyim-, sebab Dia memberikan kepada Bani Hasyim kenabian dan khilafah, sementara  yang lainnya tidak kebagian keutamaan tersebut.
  • Kendati hal itu adalah ketetapan Tuhan akan tetapi kalangan Quraisy menolak penggabungan kenabian dan khilafah dengan alasan bahwa ketetapan itu akan menyebabkan Bani Hasyim akan merasa congkak dan angkuh.
  • Khalifah Umar membekukan ketentuan Tuhan yang menetapkan hak kenabian dan khilafah bagi Bani Hasyim dan menyajikan konsep alternatif yang mencabut dari mereka hak khilafah  dan ia menyebutnya sebagai tindakan benar dan lurus.
  • Khalifah menuduh banwa Bani Hasyim curang dan dengki terhadap suku-suku Quraisy lain, sebab mereka berusaha mengambil kembali khilfaha dari Quraisy.
  • Khalifah memposisikan dirinya sebagai jubir resmi pihak Quraisy dan sekaligus sebagai pembela kepentingan-kepentingannya.
  • Orang pertama dari kalangan Quraisy yang melahirkan alasan-alasan tersebut dan menyatakannya serta merancang kekuasaan Quraisy adalah Umar bin Khaththab. jadi beliau adalah anak Quraisy yang bakti dan perancang konsep alternatif.
  • Khalifah Umar selalu mewaspadai semua keluarga besar Bani Hasyim dan khawatir mereka mengambil kembali kekuasaan khilafah dari Quraisy. Adapun sikap akrabnya terhadap Ibnu Abbas adalah mata rantai sikap politis yang bertujuan memecah belah kesatuan Bani Hasyim yang selalu setia mendukung Imam Ali as., sebagaimana sebelumnya mereka lakukan terhadap Abbas dengan menawarkan jabatan agar ia meninggalkan Ali as akan tetapi tawaran itu ditolak mentah-mentah oleh Abbas paman Nabi tersebut.

.

Tanggapan Ibnu Abbas ra. Terhadap Sikap Sayyidina Umar

  • Sesungguhnya suku-suku Quraisy, diantara mereka adalah Umar sendiri benci terhadap ketetapan Allah Swt.dengan dipilihnya Ahlulbait as. sebagai pemimpin umat Islam.
  • Sesungguhnya suku-suku Quraisy menyimpang dari kebenaran syar’iyah dan salah karena memilih selain yang di pilihkan Allah.
  • Sesungguhnya kekhawatiran Quraisy terhadap kecongkakan Bani Hasyim apabila kenabian dan khilafah ditangan meraka, walau hal itu adalah ketetapan Allah, sama sekali tidak beralasan, baik alasan syar’iyah maupun berdasar logika.
  • Suku-suku Quraisy dalam sikap politis mereka dengan meninggalkan pilihan Allah dan menentukan pilihan mereka sendiri adalah bertentangan dengan ketetapan syar’iyah. Meraka mengatakan bahwa sikap itu benar dan menuduh Ahlulbait as.yang disucikan Allah sesuci-sucinya yang berusaha mengambil kembali hak mereka yang terampas sebagai berbuat curang dan memendam rasa hasut.
  • Ibnu Abbas ra. menjelaskan bahwa Umar telah mengetahui siapa sebenarnya pemilik hak khilafah itu, yaitu Ali as. namun kendati demikian mereka merampasnya.
  • Sesungguhnya suku Quraisy mendengki dan menzalimi Ahlul-Bait as dengan merampas hak khilafah dari mereka.
  • Sesungguhnya mereka yang menyia-nyiakan hak Ahlulbait as dalam kepemimpinan umat sebenarnya meraka menzalimi diri mereka sendiri!

.

Ketidak Sukaan Suku Quraisy Terhadap Kepemiminan Ali as. Didasari Oleh Kebencian!

Dokumen dan ketarangan di bawah akan memperjelas kenyataan di atas dan sekaligus mengungkap latar belakang perampasan hak kepemimpinan Imam Ali as. yang dilakukan ooleh tokoh-tokoh Quraisy.

Kebencian bangsa Arab dan khususnya suku Quraisy terhadap Imam Ali as. adalah dikarenakan pembelaan beliau terhadap Nabi saww. dan agama Islam, sehingga dengan ketajaman pedang Ali as., musuh-musuh Islam dikalahkan, dan korban dari kalangan merekapun berjatuhan, sehingga walaupun di kemudian hari mereka memeluk Islam rasa dengki dan dendam tersebut masih ada dalam hati mereka. Apalagi mereka yang memeluk Islam bukan karena ketulusan akan tetapi karena tujuan-tujuan lain seperti: karena ikut-ikutan, menginginkan mendapatkan materi, takut terhadap kejayaan Islam dan lain lain .

Ibnu Abi al Hadid mengatakan, “Ketahuilah bahwa semua darah yang ditumpahkan Rasulullah saw. dengan pedang Ali as. dan dengan pedang yang lainnya maka orang-orang Arab sepeninggal Nabi saw. hanya akan menuntut balas semua itu kepada Ali as., dan itu adalah kebiasaan bangsa Arab apabila ada seorang dari mereka terbunuh mereka menuntut balas kepada si pembunuhnya dan apabila ia telah mati atau ada halangan untuk membalasnya maka mereka akan membalas keluarga yang paling sepadan dengan si pembunuh dari keluargnya.” [2]

Dan selain itu kedengkian itu pada sebagain mereka di kerenakan rasa iri dan hasut terhadap berbagai keistimewaan dan keutamaan Imam Ali as. yang selalu diutarakan dan di tablighkan Nabi Muhammad saww. serta kedudukan sentral yang di berikan kepada beliau as. Dan perlu di ketahui bahwa suku Quraisy adalah terkenal dengan rasa hasut dan iri serta kompetisi tidak sehat diantara mereka, sebagaimana di tegaskan oleh Khalifah Umar  kepada Abu Musa al-’Asy’ari dan Mughirah bin Syu’bah.[3]

.

Bukti-bukti Adanya Kedengkian Suku Quraisy Terhadap Imam Ali as. dan Ahlulbait as.

Dalam sebuah hadis  dari Abu Utsman an Nahdi dari Ali as. beliau berkata, “Pada suatu hari Nabi saww. memelukku sambil menangis tersedu-sedu, maka saya bertanya kepada beliau: Gerangan apa yang menyebabkan Anda menangis, wahai Rasulullah? Beliau bersabda, ‘Kedengkian terhadapmu yang ada di dada-dada beberapa kaum yang tidak akan mereka tampakkan kecuali setelah kematianku.

Saya bertanya, ‘Wahai Rasulullah, apakah dalam keselamatan agamaku?’

Beliau menjawab, ‘Ya, dalam keselamatan agamamu.’” [4]

.

Ibnu Abi al Hadid setelah membenarkan sikap Imam Ali as. bergabung dengan dewan syura yang di bentuk oleh Umar kendati beliau tahu bahwa tidak akan terpilih dan Abbas pun telah menyarankan agar beliau tidak terlibat dalam dewan tersebut, karena menurut hemat Ibnu Abi al Hadid dengan tidak ikut sertanya beliau dalam dewan itu akan menggembirakan hati kaum Quraisy sebab, “Quraisy sangat membenci Ali as.”[5]

Dalam kesempatan lain ia mengemukakan, “Ketahuilah bahwa keadaan Ali dalam hal ini (kebencian bangsa Arab terhadapnya) sangat masyhur dan tidak perlu di perpanjang lagi , tidakkah Anda menyaksikan bagaiamana pemberontakan bangsa Arab dari berbagai penjuru ketika beliau di baiat sebagai khialifah setelah dua puluh lima tahun dari wafat Nabi saw. dan semestinya dalam kurun waktu kurang dari itu kedengkian itu sudah terlupakan, tuntutan balas dendam sudah padam  dan hati-hati yang membara meredah serta terhibur, berlalunya sebuah generasi dan datangnya generasi baru dan tidak tersisa dari generasi menyandang dendam kecuali sebagaian kecil, namun demikian keadaan beliau dengan suku Quraisy setelah kurun waktu yang panjang itu seperti keadaan beliau apabila menerima jabatan khilafah langsung sepeninggal anak pamannya (Nabi) saww. dalam sisi penampakan apa yang terpendam dalam jiwa dan gejolak hati, sehingga generasi pelanjut Quraisy dan para pemuda yang tidak ikut serta menyaksikanperistiwa-peristiwa yang dilakuakan Ali as.dan penghunusan pedang terhadap pendahulu dan ayah-ayah mereka juga melakukan apa-apa yang seandainya  para pendahulu itu masih hidup tidak akan melakukan seperti itu. Lalu apa bayangan kita kalau beliau duduk di kursi khilafah sementara pedang beliau masih bercucuran darah bangsa Arab, khususnya Quraisy… [6]

Dan inilah salah satu bentuk penghianatan umat terhadap beliau seperti yang di sabdakan Nabi saww. kepada Ali as.

Habib bin Tsa’labah bin Yazid berkata : Saya mendengar Ali berkata ketika dipaksa memberi baiat untuk Abu Bakar, “Demi Tuhan langit dan bumi (beliau ucapkan tiga kali), sesungguhnya ini adalah janji Nabi yang ummi kepadaku, “Bahwa umat akan berkhianat terhadapmu sepeninggalku.[7]

.

Beberapa bukti adanya kebencian sahabat terhadap Imam Ali as.

Dalam banyak riwayat dapat kita temukan bukti adanya rasa dengki dan kebencian sebagian sahabat Nabi saww. terhadap Imam Ali as. walaupun Nabi saww. dalam banyak kesempatan telah menegaskan bahwa kebencian terhadap Imam Ali as. adalah kemunafikan. Dibawah ini akan kami sebutkan beberapa riwayat hadis yang membuktikan adanya kebencian itu .

Para muhadis seperti at-Turmudzi, ath-Thabarani, an-Nasa’i dan lain-lain meriwayatkan beberapa hadis yang menyebutkan bahwa ada sekelompok sahabat yang bersekongkol menyampaikan keluhan tentang sikap Ali as. kepada Nabi saww. ketika menjadi komandan pasukan yang di kirim ke negri Yaman dengan tujuan menjatuhkan kedudukan Ali as. di hadapan Nabi saww., melihat tindakan mereka Nabi saww. marah dan menegur mereka agar tidak membenci Ali as. seraya menegaskan bahwa Ali adalah wali mereka sepeninggal Nabi saww.

Setiap kali mereka mengeluhkan tetntang Ali as. Nabi saww. mengatakan kepada mereka dengan nada marah : Apa yang kalian maukan dari Ali? Apa yang kalian maukan dari Ali? Dia adalah pemimpin kalian setelahku . [8]

Dalam riwayat lain di katakan: “Maka Khalid bin walid [9] menulis sepucuk surat kepada Nabi saww. dan memerintah saya  (Buraidah) untuk mengecam Ali, maka saya serahkan surat itu dan saya kecam Ali ra. maka tiba–tiba berubahlah wajah Rasulullah saww. dan bersabda: Janganlah kamu membenci Ali sesungguhnya Ali dariku dan aku dari Ali dan dia adalah wali(pemimpin) kalian setelahku.” [10]

Dalam riwayat lain disebutkan: “Buraidah berkata: Maka Khalid memanggilku dan mengatakan manfa’atkan kesempatan ini dan beritakan kepada Nabi saww apa yang ia lakukan, maka saya berangkat kembali ke Madinah dan sesampainya di madinah saya menuju masjid dan ketika itu Rasulullah saww. sedang berada dirumahnya sementara sekelompok sahabat beliau di hadapan pintu rumah beliau. Mereka bertanya: Ada berita apa hai Buraidah? Saya menjawab: baik, Allah memenangkan kaum muslimin. Mereka bertanya lagi, “Lalu apa yang membawamu pulang? Saya menjawab : Ali mengambil seorang tawanan wanita dari bagaian khumus dan saya datang untuk melaporkan hal itu kepada Nabi saw.”.

Mereka serempak menjawab, “Ya, beritahukan kepada Nabi saw. agar ia jatuh di mata Nabi saw. Sementara itu Rasulullah mendenganrkan pembicaraan mereka, lalu beliau keluar dengan muka marah dan bersabda: Mengapakah gerangan ada sekelompok kaum mencela-cela Ali? Barang siapa mencela-cela Ali berarti ia mencela saya dan barang siapa meninggalkan Ali berarti telah meninggalkan saya .Sesungguhnya Ali dariku dan aku dari Ali  … .”[11]


[1] Syarah Nahj: jilidIII\12\107, Tarikh Thabari: 4\223 dan  Al Kamil Fit Tarikh: 3\62 (peristiwa tahun 23).

[2] Syarah Najh :jilid III\juz:13 hal:283.

[3] Baca dialoq lengkap mereka dalam Syarah Nahjul Balaghah :jilid:I juz 2\125-126, dan dalam dialoq tersebut Umar menegaskan bahwa yang paling hasut diantara suku Quraisy adalah Abu Bakar.

[4] Nuur al-Abshar (asy-Syablanji asy-Syafi’i):88.Cetakan Daar al-Fikr.

[5] Syarah Najh :jilid III\juz:13 hal:283.

[6] Syarah Najh :jilid III\juz:13 hal:38.

[7] Syarah Najh :jilid II\juz6 hal:18 .

[8] Hadis riwayat an-Nasa’i dalam Khashaish(dengan komentar Abu Ishaq al-hawaini) diterbitkan Daar al-Baaz Makkah ,hadis nomer 84 dengan sanad Shahih .

[9] dalam espedisi tersebut Nabi saww. mengirim dua pasukan ,satu di bawah pimpinan Khalid dan yang lain di bawah pimpinan Imam Ali as. dan Nabi saww.mengatakan : Jika kalian bertemu maka Alilah pimpinan tunggal atas pasukan itu dan jika kalian berpisah maka setiap pasukan di bawah pimpinan masing-masing ,dan sesampainya di Yaman mereka bertemu .(An-Nasa’i: hadis ke 85).

[10] Ibid. hadis nomer:85 denagn sanad hasan .

[11] Majma’ az Zawaid ;al-Haitsami,9\18 dari riwayat ath-Thabarani dalam Mu’jam Ausath

saudara pembaca…

—————————————

Berikut saya jabarkan 9 persamaan aspek kenabian Nabi Musa dan nabi Muhammad SaaW.

Aspek Kenabian Musa as
1 . Nabi, Rasul & Imam
2 . Membawa Kitab Taurat untuk Bangsa Israel.
3. Bermigrasi/Hijrah
4. Menghadap Tuhan untuk menerima perintah-Nya bagi bangsa Israel
5. Mengangkat Mantan Hamba Sahayanya menjadi Panglima Militer sebelum wafat- nya.
6. Mengangkat seorang anggota Keluarga-nya menjadi Penggantinya (Wasiy) dan sebagai Imam Pertama bagi umatnya
7. Mempunyai 12 orang Imam, dan salah satunya yang menjadi Imam Besar berasal dari keturunan Penggantinya
8. Penggantinya dan keturunannya di sucikan untuk menjadi Imam Besar Bangsa Israel
9. Kepemimpinan Penggantinya di khianati oleh sebagian umatnya

Aspek kenabian Nabi Muhammad sebagai mesiah universal
1. Nabi, Rasul, Imam dan Tuan para Nabi & Rasul/Nabi Penutup
2. Membawa Kitab Baru dari Tuhan sebagai Perjanjian Baru untuk seluruh umat manusia
3. Bermigrasi/Hijrah
4. Menghadap Tuhan untuk menerima PerintahNya bagi seluruh umat manusia.
5. Mengangkat Mantan Hamba Sahayanya menjadi Panglima Militer sebelum wafat nya.
6. Mengangkat serang anggota keluarganya sebagai penggantinya dan sebagai imam pertama bagi umatnya
7. Mempunyai 12 orang Imam dari keturunan Penggantinya
8. Penggantinya dan keturunannya di sucikan untuk menjadi Imam Universal.
9. Kepemimpinan Penggantinya di khianati oleh sebagian umatnya

Dikarenakan adanya perbedaan pandangan antara kedua golongan Islam (Sunni dan Syi’ah), maka umat Islam hanya sepakat bulat dalam pemenuhan Aspek ke-1 s/d ke-5 dari persamaan antara Nabi Muhammad SAW dan Nabi Musa as, yaitu:

Aspek-1 : Muhammad SAW adalah Nabi, Rasul, Imam dan Tuan para Nabi & Rasul/Nabi Penutup.
Muhammad itu sekali-kali bukanlah bapak dari seorang laki-laki di antara kamu, tetapi dia adalah Rasulullah dan penutup nabi-nabi. Dan adalah Allah Maha Mengetahui segala sesuatu.(QS. Al Ahzab [33] : 40).

Aspek-2 : Nabi Muhammad SAW membawa Al Qur’an yang bersisikan hukum/ perjanjian baru bagi seluruh umat Manusia.
Maha Suci Allah yang telah menurunkan Al-Furqaan (Al Qur’an) kepada hamba-Nya, agar dia menjadi pemberi peringatan kepada seluruh alam,
(QS. Al Furqon [25] : 1)

Dan Kami turunkan kepadamu Al Qur’an, agar kamu menerangkan kepada umat manusia apa yang telah diturunkan kepada mereka dan supaya mereka memikirkan,….(QS. An Nahl [16]: 44)

Aspek-3 : Nabi Muhammad SAW berhijrah dari Mekkah ke Madinah
Hai Nabi, …………..…… yang turut hijrah bersama kamu ………… Dan adalah Allah Maha Pengampun lagi Maha Penyayang.
(QS. Al Ahzab [33]: 50)

Aspek-4 : Nabi Muhammad SAW menghadap langsung Allah SWT di dalam peristiwa Isra Mi’raj.

Aspek-5 : Nabi Muhammad SAW beberapa saat menjelang kewafatannya mengangkat mantan hamba sahayanya yaitu “Zayd bin Haritzah” sebagai Panglima Pasukan, tetapi didalam pertempuran awal Zayd bin Haritzah gugur/syahid, kemudian didalam keadaan sakit yang semakin parah, Beliau SAW mengangkat Usamah bin Zayd (anak laki-2 Zayd bin Haritzah) yang masih berumur 18 tahun sebagai Panglima Pasukan menggantikan bapaknya yang mantan hamba sahaya Nabi Muhammad SAW.

Tindakan Nabi Muhammad SAW mengangkat Zayd bin Haritzah maupun Usamah bin Zayd mengundang tanda-tanya besar (kalau tidak bisa dikatakan sebagai protes halus) dikalangan para Sahabat Beliau SAW, karena masih banyak di antara para Sahabat yang berdasarkan kemampuan berperang berada jauh di atas kemampuan Zayd dan Usamah. Apalagi mengingat usia Usamah masih sangat muda untuk diangkat sebagai Panglima Pasukan.

Ke-engganan umat Islam untuk bergabung kedalam pasukan Usamah, sampai2 menyebabkan Nabi Muhammad SAW dalam keadaan sakit yang semakin parah dan hanya beberapa hari saja menjelang Beliau SAW dipanggilan ke Rahmatullah, terpaksa keluar dari kamarnya dengan dipapah dan naik ke mimbar masjid untuk berpidato menegaskan kembali akan keputusan-nya mengangkat Usamah sebagai Panglima dan memerintahkan agar pasukan Usamah segera berangkat

.
Banyak sekali umat Islam, bahkan sampai masa kini, tidak memahami latar belakang keputusan Nabi Muhammad SAW untuk mengangkat Zayd bin Haritzah dan Usamah bin Zayd sebagai Panglima Pasukan Islam, sampai2 Beliau SAW dalam keadaan sakit yang semakin parah dan hanya beberapa hari saja menjelang kewafatannya, bersikap sangat gigih mempertahankan keputusannya itu.

Tetapi jika masalah ini dilihat dari sisi Nubuat Mesianistik, khususnya berkaitan dengan Aspek Ke-5 kesamaan dengan Nabi Musa as, maka sesungguhnya sangat jelas latar belakang keputusan Nabi Muhammad SAW di dalam mengangkat Zayd bin Haritzah dan Usamah bin Zayd, yaitu Nabi Muhammad SAW se-mata2 ingin menyatakan dan membuktikan bahwa Beliau adalah sama seperti Nabi Musa as, yang menjelang kewafatannya juga mengangkat mantan hamba sahayanya menjadi Panglima Pasukan, yaitu Yusya bin Nun (Yoshua bin Nun/Nabi Dzulkifli).

Aspek -6 :Mengangkat seorang anggota Keluarganya menjadi Penggantinya/ Penerusnya (Wasiy) dan sebagai Imam Pertama bagi umatnya.

Golongan Suni :
Sekalipun mengakui adanya hadisth Nabi Muhammad SAW yang berbunyi : “Hai Ali !, Tidakkah kamu menyukai (kedudukanmu) dariku seperti kedudukan Harun as dari Musa?”
Namun hadist ini tidak dimaknai sebagai pengangkatan Ali bin Abi Thalib (sepupu dan menantu Nabi SAW) menjadi Pengganti/Penerus (Wasiy) Nabi Muhammad SAW. Golongan Suni sama sekali tidak mengakui kedudukan Ali Bin Abi Thalib sebagai Wasiy Nabi SAW, bahkan menurut mereka Wasiy Nabi SAW adalah seseorang yang dipilih/diangkat atas kesepakatan umat, dan yang pertama adalah Abu Bakar yang dipilih/diangkat di Balai Pertemuan Bani Saidah di Saqifah. Dengan demikian secara tidak disadari mereka telah menolak kemesiahan universal Nabi Muhammad Saaw.

Golongan Syi’ah:
Hadisth Nabi Muhammad SAW yang berbunyi : “Hai Ali !, Tidakkah kamu menyukai (kedudukanmu) dariku seperti kedudukan Harun as dari Musa?”, dimaknai sebagai isyarat dari Nabi Muhammad SAW bahwa Ali bin Abi Thalib adalah merupakan Penerus/Pengganti (wasiy) Beliau SAW untuk memimpin umat sebagai Imam Pertama.

Isyarat hadist di atas kemudian diwujudkan oleh Nabi Muhammad SAW sepulangnya dari Haji Wada ditengah perjalanan menuju Madinah disuatu perempatan yang dinamakan Gadhir Khum, pada tanggal 18 Dzulhijjah 10 H, dihadapan 120.000 umat Islam, berupa pengangkatan resmi Ali bin Abi Thalib sebagai Penerus/Pengganti (Wasiy) Nabi SAW sebagai pemimpin umat (Imam) setelah Nabi SAW.

Peristiwa Ghadir Khum di riwayatkan oleh 110 perawi hadist dan dimuat oleh ratusan kitab hadist baik dari Golongan Suni maupun Golongan Syi’ah. Tetapi anehnya tidak termuat di dalam 6 Kitab Hadist (Kuttubus Sittah) yang diakui oleh Golongan Suni sebagai kitab2 hadist yang sahih dan boleh dijadikan pegangan. Padahal Hadist Gadhir Khum ini merupakan Hadist Sahih yang Muttawatir (artinya kebenaran-nya dianggap mutlak karena diriwayatkan oleh banyak jalur perawi yang dipercaya)

Dengan demikian jika berpegang pada pandangan Golongan Suni, maka Nabi Muhammad SAW tidak memenuhi Aspek ke-6 dari persamaan dengan Nabi Musa, karena Beliau SAW tidak mengangkat anggota keluarganya sebagai Pemimpim/Imam umat Islam. Sedangkan menurut pandangan Golongan Syi’ah justru sebaliknya, bahwa Nabi Muhammad SAW telah memenuhi Aspek ke-6 dari persamaan dengan Nabi Musa, dengan mengangkat Ali bin Abi Thalib sebagai Wasiy Beliau SAW.

Bahwasanya Golongan Suni tidak mengakui pengangkatan Ali bin Abi Thalib tersebut, tidaklah menjadikan pengangkatan itu menjadi tidak ada. Karena bukti hadist dan sejarah tetap menunjukkan Nabi Muhammad SAW telah mengangkat salah seorang anggota keluarga-nya sebagai Penerus/Pengganti/Wasiy dan Imam Pertama bagi umatnya.

Aspek-7: Mempunyai 12 orang Imam dari keturunan Penggantinya

Golongan Suni :
Sekalipun mengakui adanya Hadisth tentang 12 Imam sebagai hadist yang sahih dan muttawatir, tetapi berpendapat bahwa pengangkatan ke-12 Imam ini adalah berdasarkan pemilihan/kesepakatan umat Islam.

Tetapi kemudian Golongan Suni mengalami kesulitan karena tidak bisa menyebutkan/menetapkan siapakah ke duabelas Imam itu, bahkan sampai ada yang nekat memasukkan yazid bin muawiyah sebagai salah satu dari 12 imam padahal ia termasuk orang yang zalim. Akhirnya Hadist 12 Imam ini tidak pernah lagi dimunculkan dalam syariat maupun aqidah Suni.

Golongan Syi’ah :
Sebaliknya Golongan Syi’ah mengakui adanya 12 Imam setelah Nabi Muhammad SAW sebagai pemimpin umat. Hanya saja berbeda dengan 12 Imam pada Nabi Musa as (Bani Israel) yang keberadaannya sekaligus 12 Imam (horizontal) pada setiap masa, maka 12 Imam pada Nabi Muhammad SAW adalah berurut kebawah (vertikal), sesuai dengan ruang-lingkup waktu misi Nabi Muhammad SAW sebagai Mesiah Universal di akhir jaman.

Adapun ke 12 Imam menurut pandangan Syiah adalah :
1. Imam ‘Ali bin Abu Thalib as – Amirul mukminin Ash Shidiq Al Faruq
2. Imam Hasan as – Al Mujtaba
3. Imam Husein as – Sayyidu Syuhada
4. Imam ‘Ali bin Husein as – As Sajjad Zainal Abidin
5. Imam Muhammad bin ‘Ali as – Al Baqir
6. Imam Ja’far bin Muhammad as – Ash Shadiq
7. Imam Musa bin Ja’far as – Al Kadzim
8. Imam ‘Ali bin Musa as – Ar Ridha
9. Imam Muhammad bin ‘Ali as – Al Jawad At Taqi
10. Imam ‘Ali bin Muhammad as – Al Hadi At Taqi
11. Imam Hasan bin ‘Ali as – Az Zaki Al Askari
12. Imam Muhammad bin Hasan as – Al Mahdi Al Qoim Al hujjah Al Muntadzar Sohib Al Zaman Hujjatullah.

Dengan demikian jika berpegang pada pandangan Golongan Suni, maka Nabi Muhammad SAW tidak memenuhi Aspek ke-7 dari persamaan dengan Nabi Musa, karena Beliau SAW tidak mempunyai 12 Pemimpim/Imam yang berasal dari keturunannya Penggantinya (Wasiy).

Sedangkan menurut pandangan Golongan Syi’ah justru sebaliknya, bahwa Nabi Muhammad SAW telah memenuhi Aspek ke-7 dari persamaan dengan Nabi Musa, karena Beliau SAW mempunyai 12 Pemimpim/Imam yang berasal dari keturunannya Penggantinya (Wasiy), yaitu dari keturunan Ali bin Abi Thalib dan Fatimah Az-Zahra Binti Muhammad SAW.

Aspek-8: Penggantinya dan keturunannya di sucikan untuk menjadi Imam Universal.

Golongan Suni :
Sekalipun mengakui bahwa bahwa ayat pada QS. Al Ahzab [33]: 33 adalah berkenaan dengan penyucian, tetapi yang disucikan adalah anggota keluarga (Ahlul Bayt) Nabi Muhammad SAW, yang terdiri dari Nabi SAW sendiri, semua isteri Beliau, anaknya (Fatimah Az-Zahra), menantunya (Ali bin Abi Thalib) dan kedua cucunya (Hasan & Husein).

Dan penyucian tersebut se-mata2 bertujuan untuk menyucikan Ahlul Bayt Nabi SAW dari semua dosa, tidak ada tujuan lainnya.

Golongan Syi’ah :
Penyucian yang dimaksud pada QS. Al Ahzab [33]: 33 hanya berkena-an dengan anggota keluarga (Ahlul Bayt) Nabi Muhammad SAW, yang terdiri dari Nabi SAW sendiri, anaknya (Fatimah Az-Zahra), menantu-nya (Ali bin Abi Thalib) dan kedua cucunya (Hasan & Husein). Sedang-kan isteri2 Nabi SAW tidak termasuk didalamnya. Asbabun Nuzul ayat ini diperkuat dengan Hadist Al Kisa yang diakui oleh seluruh umat Islam sebagai Hadist Muttawatir.

Mengapa isteri2 Nabi SAW tidak termasuk didalam “Ahlul Bayt” yang disucikan ?

Pertama, karena penyucian ini adalah dalam rangka persiapan anggota keluarga Nabi SAW untuk menduduki jabatan Imam bagi seluruh Umat Manusia (lihat : penyucian Nabi Harun as dan anak-2nya yang akan menjabat kedudukan Imam Besar umat Israel pada Tanakh/Injil Perjanjian Lama Kitab Keluaran 40: 12-15)

Kedua, adalah aneh jika isteri2 Nabi SAW yang ada pada saat QS. Al Ahzab [33]: 33 diturunkan di sucikan, tetapi isteri Nabi SAW yang paling utama dan merupakan salah satu dari 4 wanita utama umat manusia, yaitu Khadijah Al Kubra tidak ikut di sucikan, karena telah jauh sebelumnya wafat.

Dengan demikian jika berpegang pada pandangan Golongan Suni, maka Nabi Muhammad SAW tidak memenuhi Aspek ke-8 persamaan dengan Nabi Musa, karena penyucian terhadap anggota keluarga Nabi SAW tidak ada kaitannya dengan pengangkatan Pemimpin/Imam

Sedangkan menurut pandangan Golongan Syi’ah justru sebaliknya, bahwa Nabi Muhammad SAW telah memenuhi Aspek ke-6 dari persamaan dengan Nabi Musa, karena penyucian anggota keluarga Nabi SAW adalah justru dalam rangka persiapan menjadi Imam bagi Penggantinya (Wasiy) yaitu Ali bin Abi Thalib beserta anak2nya.

Aspek-9: Kepemimpinan Penggantinya di khianati oleh sebagian umatnya

Golongan Suni :
Karena tidak mengakui pengangkatan Imam ‘Ali bin Abi Thalib sebagai Penerus/Pengganti Nabi Muhammad SAW dengan kedudukan Imam (pemimpin) bagi umat Islam, maka Golongan Suni berpandangan tidak ada perbuatan penghianatan terhadap kepemimpinan Penerus/-Pengganti Nabi Muhammad saw.

Pengangkatan Abu Bakar sebagai Khalifah setelah wafatnya Nabi Muhammad saw adalah sah menurut golongan sunni karena didasarkan pada kesepakatan (musyawarah) umat Islam yang dilaksanakan di Saqifah, Balai Pertemuan Bani Saidah.

Golongan Syi’ah:
Pengangkatan Ali bin Abi Thalib sebagai Imam (pemimpin) umat Islam (setelah Nabi SAW) oleh Nabi Muhammad SAW sendiri di Gadhir Khum adalah merupakan ketetapan Nabi SAW yang wajib di taati. Jika kemudian segelintir umat Islam yang berkumpul di Balai Pertemuan Saqifah Bani Saidah, memilih Abu Bakar sebagai Khalifah pertama setelah wafatnya Nabi SAW, maka perbuatan itu merupakan pembangkangan terhadap Ketetapan Nabi Muhammad SAW serta merupakan pengkhianatan terhadap Ali bin Abi Thalib yang telah diangkat sebagai Pemimpin/Imam Umat Islam. (Lihat Peristiwa Penolakan Bani Israel terhadap Pengangkatan Nabi Harun as sebagai Pengganti/Penerus Nabi Musa as pada Kemah Pertemuan Bani Korah, pada halam 32 s/d 36 )

Dengan demikian jika berpegang pada pandangan Golongan Suni, maka Nabi Muhammad SAW tidak memenuhi Aspek ke-9 persamaan dengan Nabi Musa as, karena tidak ada perbuatan penghianatan terhadap Pemimpin/Imam, sebab memang Beliau SAW tidak pernah mengangkat anggota keluarganya (Ali bin Abi Thalib as) sebagai Pemimpin/Imam umat Islam sepeninggal Nabi Muhammad SAW.

Sedangkan menurut pandangan Golongan Syi’ah justru sebaliknya, bahwa Nabi Muhammad SAW telah memenuhi Aspek ke-9 dari persamaan dengan Nabi Musa, karena pengangkatan Abu Bakar sebagai Khalifah pertama di Saqifah Bani Saidah jelas merupakan tindakan penghianatan terhadap Ali bin Abi Thalib yang telah diangkat oleh Nabi Muhammad SAW sebagai Pemimpin/Imam Umat Islam di Gadhir Khum pada tanggal 18 Dzulhijjah 10 H.

Perbedaan pandangan diantara Golongan Suni dan Golongan Syi’ah di atas, membawa implikasi terhadap pemenuhan kriteria Nabi Muhammad SAW sebagai Sang Mesiah Universal, khususnya dalam dalam kriteria “sama seperti Nabi Musa as” .

Apabila mengikuti pandangan Golongan Suni, maka tentunya akan sulit meyakinkan umat beragama lainnya tentang keabsahan Nabi Muhammad SAW sebagai Sang Mesiah Universal, karena pandangan Golongan Suni menafikan (menolak) adanya kesamaan antara Nabi Muhammad SAW dengan Nabi Musa as, khususnya berkaitan dengan Aspek Kenabian Ke-6 s/d Ke-9.
Sedangkan menurut pandangan Golongan Syi’ah, keseluruhan Aspek Kenabian (9 Aspek) pada Nabi Muhammad SAW adalah sesuai/sama seperti Nabi Musa as, sehingga menurut pandangan Golongan Syi’ah, tidak ada keraguan sedikitpun dan sepenuhnya dapat dibuktikan tentang keabsahan Nabi Muhammad SAW sebagai Sang Mesiah Universal.

Adanya dua pandangan yang berbeda di antara umat Islam tentang pemenuhan persyaratan kesamaan 9 aspek kenabian antara Nabi Muhammad SAW dengan Nabi Musa as sebagaimana di uraikan di atas, sesungguhnya tidak membawa konsekwensi apapun terhadap keabsahan Nabi Muhammad SAW sebagai Sang Mesiah Universal.

Sebagaimana dapat dimisalkan dengan 3 (tiga) orang buta yang berkumpul pada sebuah tanah lapang di siang hari. Ketiganya tidak bisa melihat matahari yang sedang bersinar terang. Tetapi ketidak mampuan mereka untuk melihat matahari, tidaklah berarti atau tidaklah mengakibatkan matahari tersebut menjadi tidak ada. Keberadaan Matahari tidak tergantung dari mampu atau tidak mampunya manusia melihatnya.

Demikian juga kebenaran dan keabsahan Nabi Muhammad SAW sebagai Sang Mesiah Universal tidaklah tergantung pada pandangan golongan-2 umat Islam yang menafikan adanya unsur2/faktor2 persyaratan sebagai Mesiah Universal pada diri Nabi Muhammad SAW, sekalipun mereka itu merupakan golongan yang mayoritas dari umat Islam.

Dalam kontek inilah hendaknya dipahami firman Allah SWT berikut ini :

Dan jika kamu menuruti kebanyakan orang-orang yang di muka bumi ini, niscaya mereka akan menyesatkanmu dari jalan Allah. Mereka tidak lain hanyalah mengikuti persangkaan belaka, dan mereka tidak lain hanyalah berdusta (terhadap Allah). (QS. Al An’am [6]: 116)

Hai orang-orang yang beriman, janganlah kamu mengambil jadi pemimpinmu, orang-orang yang membuat agamamu jadi buah ejekan dan permainan, (yaitu) di antara orang-orang yang telah diberi Kitab sebelummu, dan orang-orang yang kafir (orang-orang musyrik). Dan bertakwalah kepada Allah jika kamu betul-betul orang-orang yang beriman.(QS. Al Maidah [5]: 57)

Sekalipun pandangan Golongan Suni seperti yang diuraikan di atas mengakibat-kan sebahagian aspek kenabian Nabi Muhammad SAW menjadi “tidak seperti Nabi Musa as”, yaitu aspek ke-6 s/d ke-9, namun hal ini bukan berarti Golongan Suni tidak mempercayai/meyakini bahwasanya Nabi Muhammad SAW adalah “Pembawa Rahmat bagi Alam Semesta” yang bermakna juga sebagai Mesiah Universal. Hanya saja keyakinan tersebut se-mata2 di dasarkan pada Al Qur’an, tanpa didukung pembuktian yang terukur dengan alat ukur yang telah ditentukan berdasarkan Nubuat2 Mesianistik, sehingga keyakinan termaksud tidak dapat dijadikan hujjah (argumentasi) untuk menyakinkan umat non-Islam (yang tidak mempercayai Al Qur’an) tentang aspek kenabian Nabi Muhammad SAW yang “sama seperti Nabi Musa as”.

Dilain pihak, pandangan Golongan Suni yang berkaitan dengan Nubuat Mesianistik ini justru menguntungkan umat agama lainnya, terutama Umat agama Yahudi. Mengapa ?

Aqidah agama Yahudi sepenuhnya bertumpu pada harapan kedatangan Sang Mesiah Universal yang akan mengangkat derajat bangsa Israel pada tingkat yang paling tinggi di antara semua bangsa yang ada di dunia. Tanpa adanya harapan ini, maka umat Yahudi akan tercerai-berai mengikuti agama-agama lainnya.

Apabila ternyata Sang Mesiah Universal (yang di-tunggu2) sudah datang dan derajat Bangsa Israel tidak terangkat sampai puncak yang paling tinggi di antara umat manusia, maka tentunya kenyataan itu akan menghapuskan harapan umat Yahudi, dan pada gilirannya akan menghancurkan sendi2 ke-imanan mereka akan kebenaran agama Yahudi.

Oleh karena itu selama harapan umat Yahudi belum terwujud, maka mereka akan dan harus menolak semua klaim atas kemunculan Mesiah Universal yang tidak sejalan dengan harapan2 mereka.

Sebenarnya para pemimpin agama Yahudi (Rabi2) sejak awal kelahiran Nabi Muhammad SAW telah mengetahui bahwa Beliau SAW merupakan Mesiah Universal yang ditunggu2 dan dikhabarkan di dalam Nubuat2 Mesianistik pada Kitab2 Suci terdahulu. Hal inilah yang dikatakan di dalam Al Qur’an :

Orang-orang (Yahudi dan Nasrani) yang telah Kami beri Al Kitab (Taurat dan Injil) mengenal Muhammad seperti mereka mengenal anak-anaknya sendiri. Dan sesungguhnya sebahagian di antara mereka menyembunyikan kebenaran, padahal mereka mengetahui.(QS. Al Baqarah [2] : 146)

(Yaitu) orang-orang yang mengikut Rasul, Nabi yang ummi yang (namanya) mereka dapati tertulis di dalam Taurat dan Injil yang ada di sisi mereka, yang menyuruh mereka mengerjakan yang ma`ruf dan melarang mereka dari mengerjakan yang mungkar dan menghalalkan bagi mereka segala yang baik dan mengharamkan bagi mereka segala yang buruk dan membuang dari mereka beban-beban dan belenggu-belenggu yang ada pada mereka. Maka orang-orang yang beriman kepadanya, memuliakannya, menolongnya dan mengikuti cahaya yang terang yang diturunkan kepadanya (Al Qur’an), mereka itulah orang-orang yang beruntung.(QS. Al A’raf [7]: 157)

Keberadaan komunitas Yahudi di Semenanjung Arab (Madinah dan Khaibar) sebenarnya dilatar belakangi oleh pengetahuan mereka tentang kedatangan Mesiah Universal dari wilayah ini. Umat Yahudi memang me-nunggu2 kedatangan Sang Mesiah Universal tetapi bukan untuk mengikutinya, melainkan untuk menggagalkan baik kedatangan maupun misi Sang Mesiah Universal ini. Karena kedatangan Mesiah Universal dari tanah Arab yang bukan berasal dari keturunan Nabi Ishak as dan bukan pula dari garis keturunan Nabi Daud as (Suku Yehuda), akan membuka rahasia kepalsuan nubuat2 mesianistik yang mereka buat2 sendiri dan pada gilirannya akan memporak-porandakan sendi-2 aqidah dan keimanan agama Yahudi.

Sejarah Islam meriwayatkan hal-2 yang berkaitan dengan aktivitas umat Yahudi di Semenanjung Arab guna menggagalkan kedatangan dan misi Nabi Muhammad SAW sebagai Mesiah Universal, di antaranya :

1. Dimasa kanak2 nya Nabi Muhammad SAW diriwayatkan adanya peringatan tentang usaha pembunuhan atas Nabi Muhammad SAW oleh orang2 Yahudi ;

2. Selama Nabi Muhammad SAW berada di Madinah, sejak awal sampai akhir umat Yahudi baik secara terang2an maupun sembunyi2 (bekerja sama dengan kaum Musyrik Mekkah) senantiasa berupaya menggagalkan misi Nabi Muhammad SAW.

3. Setelah Nabi Muhammad SAW wafat, umat Yahudi tetap berupaya merusak agama Islam yang dibawa oleh Nabi Muhammad SAW dari dalam dengan cara membuat hadist2 palsu, yang dikenal sebagai “Hadist Israiliyat”, bekerjasama dengan beberapa unsur umat Islam (munafiqun).

Pandangan dikalangan mayoritas umat Islam sendiri yang secara langsung berakibat (se-olah2) aspek kenabian Nabi Muhammad SAW tidak sama seperti aspek kenabian Nabi Musa as, sangat sejalan dengan keinginan dan kepentingan umat Yahudi sejak awal, dengan demikian para pemimpin agama Yahudi dapat mengatakan kepada umatnya :

“Hai Bani Israel !!! Lihatlah mayoritas umat Islam sendiri tidak mengakui bahwa Nabi mereka “sama seperti Nabi Musa”, artinya Nabi mereka (Nabi Muhammad SAW) bukanlah Sang Mesiah Universal yang kita tunggu. Mesiah Universal dari keturunan Nabi Ishak dan Nabi Daud belum datang !”

Keselarasan antara pandangan Golongan Suni dengan keinginan/kepentingan umat Yahudi berkenaan dengan Ke-Mesiah-an Nabi Muhammad SAW, mungkin hanya kebetulan saja. Tetapi mungkin juga bukan hal yang kebetulan.

Bukankah Sejarah Islam juga meriwayatkan keberadaan figur Kaab Al-Akhbar, seorang ulama Yahudi yang kemudian masuk Islam dimasa pasca wafatnya Nabi Muhammad SAW ? Kedekatan Kaab Al-Akhbar dengan beberapa tokoh puncak umat Islam di masa itu, yaitu Khalifah Umar bin Khattab ra, Khalifah Utsman bin Affan ra , serta Abu Hurairah ra (perawi hadist terbanyak dilingkungan Golongan Suni) juga banyak diriwayatkan di dalam kitab2 sejarah Islam.

Melihat kenyataan bahwa pandangan Golongan Suni yang sejalan dan selaras dengan keinginan/kepentingan agama/kaum Yahudi, bukankah cukup alasan untuk berspekulasi, bahwa Kaab Al-Akhbar mungkin telah berhasil memasukan pemikirannya kedalam pandangan Golongan Suni melalui hadist2 Israiliyatnya, seperti hadist di bawah ini :

Dari Abu Hurairah r.a. berkata: “Dua orang bercaci maki, seorang dari kaum Muslim dan seorang dari Yahudi. Orang Muslim itu berkata: ……………………………………….., lalu Nabi SAW bersabda: “Janganlah kalian memilih aku atas Musa karena besok pada hari Qiyamat manusia pingsan dan akupun pingsan bersama mereka, Aku adalah orang yang mula pertama sadar, tiba-tiba Musa memegang pada satu segi Arasy, maka aku tidak tahu apakah ia termasuk orang yang pingsan dan sadar sebelum aku, atau ia termasuk orang yang dikecualikan Allah”.

Pada hadist yang diriwayat oleh Abu Hurairah ra (yang sangat erat hubungannya dengan Kaab Al Akhbar) di atas, menjelaskan bahwa Nabi Musa as dibangunkan Allah SWT lebih dahulu dahulu daripada Nabi Muhammad SAW di Hari Kiamat, halmana menunjukan bahwa kedudukan Nabi Musa as lebih utama dibandingkan dengan kedudukan Nabi Muhammad SAW.

———————————————————————————–

Memahami Kedudukan Nabi Muhammad SAW sebagai Mesiah Universal

Ketidakpahaman mayoritas umat Islam (Golongan Suni) terhadap kedudukan dan fungsi Nabi Muhammad SAW selaku Mesiah Universal/Juru Selamat Umat Manusia/Pembawa Rahmat bagi Alam Semesta, yang berpangkal pada penolakan persamaan aspek kenabian ke-6 s/d ke-6 antara Nabi Muhammad SAW dengan Nabi Musa as, kemudian mempengaruhi pandangan mayoritas umat Islam terhadap sosok dan kepribadian Nabi Muhammad SAW, yang pada akhirnya secara langsung mempengaruhi aqidah dan syariat ke-Islam-an mereka.

Sebagai konsekwensinya, maka selama mayoritas umat Islam belum mampu memahami kedudukkan dan fungsi Nabi Muhammad SAW sebagai Mesiah Universal, maka selama itu pula mayoritas umat Islam tidak akan mampu memahami ajaran agamanya secara utuh.

Sebagai Rahmatan lil Alamin, Nabi Muhammad SAW tidaklah sama seperti semua manusia lainnya yang pernah di ciptakan Allah SWT, Beliau SAW adalah se-mulia2-nya manusia yang pernah diciptakan oleh Allah SWT. Sehubungan dengan ini Allah SWT berfirman dalam Al Qur’an :

Sesungguhnya Allah dan malaikat-malaikat-Nya bershalawat untuk Nabi. Hai orang-orang yang beriman, bershalawatlah kamu untuk Nabi dan ucapkanlah salam penghormatan kepadanya.
QS. Al Ahzab [33]: 56

Tidak ada satupun manusia sejak Nabi Adam as sampai Hari Kiamat nanti yang memperoleh kehormatan dari Allah SWT sedemikian tingginya kecuali terhadap Nabi Muhammad SAW. Allah SWT memerintahkan umat manusia untuk mendirikan shalat, melaksanakan puasa, berzakat, beramal-soleh dan sebagainya, tetapi tentunya Allah SWT sendiri tidaklah melakukan/mengerjakan apa2 yang diperintahkanNya kepada umat manusia itu.

Namun berkenaan dengan Nabi Muhammad SAW, sebelum Allah SWT memerintahkan umat manusia untuk memberikan salam penghormatan (ber-shalawat) kepada Beliau SAW, Allah SWT sendiri beserta seluruh Malaikat telah terlebih dahulu dan terus senantiasa memberikan salam penghormatan (ber-shalawat) kepada Nabi Muhammad SAW.

Apakah Nabi SAW “maksum”?

Jikalau Para Imam Bani Israel dari keturunan Nabi Harun as dan para Imam dari ke-12 Suku Bani Israel saja disucikan oleh Allah SWT, yang artinya “maksum” yaitu setiap saat dicegah dari perbuatan melakukan kesalahan/dosa. Maka tentunya Nabi Muhammad SAW dan Para Imam Penerus (Wasiy) Beliau SAW yang berlingkup untuk seluruh umat manusia (Universal) lebih dapat dipastikan “ke-maksuman-nya”, sebagaimana telah ditetapkan oleh Allah SWT di dalam QS. Al Ahzab [33] : 33

Sementara ini kalangan mayoritas umat Islam mengakui bahwa Nabi Muhammad SAW hanya “maksum” pada saat menerima dan memberitakan wahyu Al Qur’an, sedangkan diluar itu Beliau SAW adalah seperti manusia biasa lainnya, yang dapat berbuat salah dan dosa. Sebagai akibat pemahaman ini sering kali terdengar ucapan di antara umat Islam: “Ah tidak apa2 koq berbuat salah, karena Nabi Muhammad SAW juga acapkali berbuat salah, Beliau kan hanya manusia biasa seperti kita”.

Jika benar Nabi Muhammad SAW bisa berbuat salah dan dosa (diluar saat menerima dan memberitakan wahyu Al Qur’an), maka bagaimana mungkin umat Islam diwajibkan berpegang pada Sunnah Beliau SAW? Bukankah dengan demikian di antara sunah2 Nabi SAW itu terbuka kemungkinan mencakup pula perkataan atau perbuatan Beliau SAW yang salah dan mengandung dosa? Dan jika Nabi Muhammad SAW adalah seperti manusia biasa yang bisa berbuat salah dan dosa, bagaimana mungkin Allah SWT justru memerintahkan seluruh umat manusia sampai Hari Kiamat untuk menjadikan Beliau SAW sebagai suri tauladan yang baik, sebagaimana firman Allah SWT :

Sesungguhnya telah ada pada (diri) Rasulullah itu suri teladan yang baik bagimu (yaitu) bagi orang yang mengharap (rahmat) Allah dan (kedatangan) hari kiamat dan dia banyak menyebut Allah.(QS. Al Ahzab [33] : 21)

Ucapan di atas sungguh2 merendahkan derajat dan kedudukan Nabi Muhammad SAW sebagai Rahmatan lil Alamin (Mesiah Universal), bagaimana mungkin kedudukan Nabi Muhammad SAW ditempatkan di bawah Para Imam Bani Israel yang dijamin Allah SWT tidak akan melakukan kesalahan/dosa karena mereka telah di sucikan (maksum).

Padahal dilain pihak mayoritas umat Islam mengakui adanya Hadist yang berbunyi: “Ulama2 dari umatku kedudukannya lebih tinggi dari nabi2 Bani Israel”. Para Imam Bani Israel itu kedudukannya lebih rendah dari nabi2 Bani Israel, dan Nabi Muhammad SAW ditempatkan dibawah para Imam Bani Israel, tetapi dilain pihak ulama2 umat Islam berada di atas nabi2 Bani Israel. Jadinya kedudukan Nabi Muhammad SAW berada jauh dibawah ulama2 umatnya sendiri ?

Cara berpikir mayoritas umat Islam yang kontradiktif di atas se-mata2 dikarenakan ketidakpahaman mereka terhadap kedudukan Nabi Muhammad SAW sebagai Mesiah Universal, Juru Selamat dan Pembawa Rahmat bagi seluruh umat Manusia. (Rahmatan lil Alamin)

Nabi SAW “bermuka masam”

Perendahan/pelecehan kedudukan Nabi Muhammad SAW oleh mayoritas umat Islam tidak saja terjadi pada tingkatan pembicaraan2 ringan se-hari2, melainkan lebih jauh lagi, yaitu dalam menafsirkan ayat2 Al Qur’an menisbahkan (melekatkan) hal2 yang tercela kepada Beliau SAW, seperti terjadi pada penafsiran yang umum atas Surat Abasa [80] : 1-2, yang merupakan Surat Makkiyah Ke-24 :

Dia (Muhammad) bermuka masam dan berpaling, karena telah datang seorang buta kepadanya,

Padahal pada Surat Al Qalam [68] : 4, yang merupakan Surat Makkiyah Ke-2, Allah SWT berfirman :

Dan sesungguhnya kamu benar-benar berbudi pekerti yang agung.

Bagaimana mungkin dapat dipahami oleh akal yang sehat bahwa Nabi Muhammad SAW yang Allah SWT sendiri telah mengatakan “berbudi pekerti yang agung”, malah bermuka masam dan berpaling ketika seorang pengikutnya yang saleh lagi buta menemuinya (Abdullah bin Ummi Maktum).
Disamping itu wahyu Al Qur’an itu diturunkan oleh Allah SWT kepada Nabi Muhammad SAW, halmana artinya komunikasi yang terjadi adalah antara Allah SAW (melalui Malaikat Jibril as) dan Nabi Muhammad SAW.

Dalam komunikasi dua pihak, maka tentunya kata ganti orang yang digunakan adalah kata ganti orang kedua (kamu, engkau dsb), bukan kata ganti orang ketiga (dia, mereka), karena kata orang ketiga mengandung arti yang bersangkutan tidak termasuk didalam komunikasi dua pihak.

Karena QS. Abasa [80]: 1 ditafsirkan : “Dia (Muhammad)….”, maka berarti Nabi Muhammad SAW merupakan orang ketiga yang tidak termasuk di dalam komunikasi antara Allah SWT dengan orang yang menerima wahyu Al Qur’an termaksud. Jadi kepada siapakah wahyu Surat Abasa ini diturunkan ? Atau berarti juga wahyu Al Qur’an ditafsirkan tidak saja turun kepada Nabi Muhammad SAW tetapi juga ada orang lain?

Nabi SAW “kena sihir”

Kalangan mayoritas umat Islam mempercayai bahwa di Madinah Nabi Muhammad SAW terkena sihir yang dilakukan orang orang Yahudi, sehingga selama 3 hari Beliau SAW menjadi “linglung”, berdasarkan hadist yang di riwayatkan oleh Ummul Mukminin Aisyah ra dan dimuat pada Kitab Sahih Bukhari.

Hadist ini jelas Dhaif (palsu), karena :

1. Jika benar Nabi SAW terkena sihir, maka benarlah tuduhkan kaum kaum musyrik yang mengatakan Nabi Muhammad SAW hanyalah seorang yang kena sihir, sebagaimana diberitakan dalam Al Qur’an :

Kami lebih mengetahui dalam keadaan bagaimana mereka mendengarkan sewaktu mereka mendengarkan kamu, dan sewaktu mereka berbisik-bisik (yaitu) ketika orang-orang zalim itu berkata: “Kamu tidak lain hanyalah mengikuti seorang laki-laki yang kena sihir”.(QS. Al Isra [17]: 47)

atau (mengapa tidak) diturunkan kepadanya perbendaharaan, atau (mengapa tidak) ada kebun baginya, yang dia dapat makan dari (hasil) nya?” Dan orang-orang yang zalim itu berkata: “Kamu sekalian tidak lain hanyalah mengikuti seorang lelaki yang kena sihir.”
(QS. Al Furqon [25]: 8)

2. Sihir adalah perbuatan syaitan, dan syaitan tidak bisa menggangu orang2 yang mukhlas, sedangkan Nabi Muhammad SAW pastilah lebih lagi dari sekedar orang yang mukhlas.

Dan mereka mengikuti apa yang dibaca oleh syaitan-syaitan pada masa kerajaan Sulaiman (dan mereka mengatakan bahwa Sulaiman itu mengerjakan sihir), padahal Sulaiman tidak kafir (tidak mengerjakan sihir), hanya syaitan-syaitan itulah yang kafir (mengerjakan sihir). Mereka mengajarkan sihir kepada manusia ……….(QS. Al Baqarah [2]: 102)

Iblis menjawab: “Demi kekuasaan Engkau aku akan menyesatkan mereka semuanya, kecuali hamba-hamba-Mu yang mukhlis di antara mereka.(QS. Shaad [38]: 82-83)

Hadist Dhaif tentang Nabi Muhammad SAW terkena sihir yang diriwayatkan oleh Aisyah ra (Kitab Sahih Bukhari) ini kemudian diperkuat lagi dengan hadist2 lainnya (seperti pada Kitab Hadist Al Baihaqi), yang meriwayatkan ketika Nabi SAW terkena sihir inilah Allah SWT menurunkan Surat Al Falaq dan Surat An Nas (Surat Al Mu’awwidzatain), padahal kedua surat tersebut turun di Mekkah sebagai Surat Makkiyah Ke-20 dan Ke-22, sedangkan menurut riwayat hadistnya Nabi SAW terkena sihir ketika di Madinah.

Ketiga contoh di atas tentang rendahnya pandangan dan penghargaan mayoritas Umat Islam terhadap Nabi Muhammad SAW, hanya sekedar mewakili dari banyak lagi contoh2 lainnya yang sejenis, dimana jika dijelaskan satu persatu, niscaya dapat disusun ke dalam sebuah buku tebal tersendiri.
Pandangan dan penghargaan mayoritas umat Islam terhadap Nabi Muhammad SAW sebagaimana digambarkan di atas jelas sekali bertentangan dengan kedudukan dan fungsi Beliau SAW sebagai Mesiah Universal/Juru Selamat dan Pembawa Rahmat bagi umat manusia serta seluruh alam semesta.

Dengan keadaan seperti ini bagaimana mungkin umat Islam mampu menyakinkan umat agama lainnya tentang kebenaran ajaran Agama Islam, karena syarat utama kebenaran ajaran agama samawi di akhir jaman adalah bahwa Nabi Pembawa Risalahnya haruslah memenuhi persyaratan sebagai Sang Mesiah Universal.

Dan sebaliknya, rendahnya penghargaan umat Islam terhadap Nabi Muhammad SAW, justru dapat dijadikan senjata oleh umat agama lainnya, dimana mereka akan mengatakan, “lihat ! umat Islam sendiri mengakui bahwa Nabi Muhammad SAW mempunyai banyak kelemahan seperti layaknya manusia biasa, jadi mana mungkin Nabi Muhammad SAW bisa di akui sebagai Sang Mesiah Universal”.

Kesimpulan/Penutup

1. Ditinjau dari aspek ajarannya, maka pada hakekatnya semua agama samawi mengandung ajaran yang sama, baik pada segi Tauhid maupun Aqidahnya, yang berbeda adalah pada segi syariatnya saja, karena disesuaikan dengan kondisi ruang dan waktunya.

Semua agama samawi mengajarkan bahwa Tuhan itu Esa, Tuhan itu adalah Maha Pencipta Alam Semesta berserta Isinya, sembahlah Tuhan Yang Esa jangan menduakanNya, berlombalah berbuat kebaikan dan janganlah berbuatan kejahatan. Perbedaannya hanyalah berkaitan dengan muatan materi ajarannya yang disesuaikan dengan kemampuan umat manusia pada kurun waktunya untuk memahami ajaran agama yang bersangkutan.

Mungkin tahapan perkembangan muatan materi ajaran agama2 samawi ini dapat di ibaratkan seperti pelajaran pada jenjang pendidikan formal yang ada.
Ajaran agama (pesan Ilahiyah) yang dibawakan oleh Nabi Nuh as sampai Nabi Saleh as (Kaum Tsamud), dapat di umpamakan seperti pelajaran bagi tingkat Taman Kanak2 dan Sekolah Dasar.

Ajaran agama yang dibawa oleh Nabi Ibrahim as sampai Nabi Yunus as, dapat di umpamakan seperti pelajaran bagi tingkat Sekolah Dasar. Kemudian ajaran agama yang dibawakan oleh Nabi Musa as sampai Nabi Zakaria as & Nabi Yahya as, dapat di umpamakan seperti pelajaran bagi tingkat Sekolah Lanjutan Pertama. Sedangkan ajaran agama yang dibawakan oleh Nabi Isa as diumpamakan seperti pelajaran bagi Sekolah Lanjutan Atas, dan sekaligus mempersiapkan Bani Israel untuk memasuki jenjang pendidikan di Perguruan Tinggi. Akhirnya, ajaran agama yang dibawakan oleh Nabi Muhammad SAW adalah untuk tingkatan pendidikan yang terakhir, yaitu tingkat Perguruan Tinggi sampai mencapai gelar akademis yang tertinggi, yaitu Tingkat S-3. Seluruh ajaran agama yang dibawa sejak Nabi Adam as sampai ke Nabi Muhammad SAW merupakan satu paket pelajaran pendidikan formal yang terpadu, selaras dan sejalan sesuai dengan tingkatannya, dan paket ajaran ini namanya “Islam”.

2. Agama-2 Samawi pada hakekatnya bertumpu pada dua aspek, yaitu aspek ajaran (aqidah dan syariat) dan aspek sosok/figur Pembawa Risalah Agama yang bersangkutan (Nabi/Rasul) berkaitan dengan kedudukan dan fungsi Juru Selamat/Pembawa Rahmat bagi Kaum tertentu atau bagi seluruh Umat Manusia (Mesiah Universal). Kedua aspek agama samawi ini merupakan satu kesatuan yang tidak bisa dipisahkan dalam rangka memperoleh pemahaman yang seutuhnya atas masing2 agama samawi yang bersangkutan.

Oleh karena itu ajaran Agama Yahudi tidaklah mungkin dapat dipahami secara utuh tanpa memahami kedudukan dan fungsi Nabi Musa as, Pembawa Risalah Agama Yahudi dengan Kitab Tauratnya (dan juga Nabi Daud as dengan Kitab Zaburnya) sebagai Juru Selamat Bani Israel (Mesiah Bani Israel).

Demikian juga, Agama Nasrani/Kristen tidaklah mungkin dapat dipahami secara utuh tanpa memahami kedudukan dan fungsi Nabi Isa as (Yesus), Pembawa Risalah Agama Nasrani dengan Kitab Injilnya, sebagai Nabi Terakhir/Penutup Bani Israel dan sekaligus Juru Selamat Bani Israel, yang dikirim oleh Allah SWT guna memberikan peringatan kepada Bani Israel atas penyelewengan2 yang telah mereka dilakukan dan sekaligus mempersiapkan Bani Israel untuk menyongsong kehadiran Sang Juru Selamat/Pembawa Rahmat bagi seluruh umat manusia (Sang Mesiah Universal).

Dan terlebih lagi tentunya dengan Agama Islam yang dibawa oleh Nabi Muhammad SAW bagi seluruh umat manusia. Ajaran Agama Islam mutlak hanya mungkin dipahami secara utuh dan benar dengan bertitik pangkal pada pemahaman tentang kedudukan dan fungsi Nabi Muhammad SAW sebagai Juru Selamat/Pembawa Rahmat bagi seluruh umat manusia dan alam semesta (Rahmatan lil Alamin), yaitu sebagai Sang Mesiah Universal.

3. Kehadiran Mesiah Universal yang dijanjikan menjadi “Thema Sentral” agama2 samawi, dimana hampir semua Nabi yang di utus oleh Allah SWT memberitakan tentang ciri2 dari Sang Mesiah Universal tersebut. Berita2 atau Riwayat2 tentang Mesiah yang terdapat pada Kitab2 Suci Agama Samawi disebut pula sebagai “Nubuat Mesianistik”.

Adapun ciri utama Sang Mesiah Universal menurut Nubuat Mesianistik yang diakui oleh semua agama samawi adalah:

1). Sang Mesiah Universal berasal dari keturunan anaknya Nabi Ibrahim as yang dikorbankan,

2). Sang Mesiah Universal itu memiliki kesamaan dalam aspek kenabian dengan Nabi Musa as.

4. Di dalam perkembangan sejarahnya agama2 samawi ternyata tidak dapat bebaskan dirinya dari pengaruh2 kepentingan umatnya untuk mengaku/-mengklaim bahwa masing2 agama merupakan satu2nya agama yang benar dan Nabi Pembawa Risalah Agamnya adalah Sang Mesiah Universal yang ditunggu oleh segenap penganut agama samawi.

Untuk memperkuat klaim tersebut tidak segan2 pula para pemuka agama samawi, dalam hal ini Agama Yahudi, merubah bagian2 tertentu dari Kitab Suci Taurat (Tanakh), agar ciri2 Sang Mesiah Universal sesuai dan sejalan dengan apa yang mereka kehendaki.

Akhirnya, dapat kiranya disimpulkan bahwa perbedaan agama yang ada diantara agama2 samawi adalah bersumber dari persoalan siapakah anak Nabi Ibrahim yang dikorban itu, Ismail-kah atau Ishak-kah dan persoalan Nabi siapakah yang memiliki kesamaan dalam aspek kenabiannya dengan Nabi Musa as.
Kedua persoalan yang nampaknya sangat simpel, tetapi tidak mampu diselesaikan oleh umat manusia.
Dan kedua persoalan ini semata-mata membuktikan betapa benarnya firman Allah SWT,

…………..Sekiranya Allah menghendaki, niscaya kamu dijadikan-Nya satu umat (saja), tetapi Allah hendak menguji kamu terhadap pemberian-Nya kepadamu, maka berlomba-lombalah berbuat kebajikan. Hanya kepada Allah-lah kembali kamu semuanya, lalu diberitahukan-Nya kepadamu apa yang telah kamu perselisihkan itu,(QS. Al Maidah [5]: 48)

Dari ayat QS. Al Maidah [5]: 48 di atas sebenarnya sangat terang dan jelas, dimana melalui ayat tersebut Allah SWT menyatakan sesungguhnya sangat mudah bagi Allah SWT untuk menjadikan umat manusia seluruhnya sepakat terhadap siapakah yang sebenarnya Mesiah Universal itu (‘pemberian-Nya”), tetapi Allah SWT justru menjadikan “pemberian-Nya kepadamu” yaitu Sang Mesiah Universal untuk seluruh umat manusia itu sebagai ujian bagi umat manusia apakah mampu mengenali dan mengimani Sang Mesiah Universal itu.

Tetapi pada akhirnya, ketika umat manusia kembali kepada Allah SWT, maka Dia akan memberitahukan siapakah yang sebenarnya Sang Mesiah Universal itu, yang selalu diperselisihkan oleh umat manusia.

Sebagaimana layaknya suatu ujian, maka pemberitahuan Allah SWT tentang siapakah sebenarnya Sang Mesiah Universal adalah juga merupakan jawaban yang berfungsi untuk menilai keberhasilan ujian termaksud.

Bilamana selama hidup di dunia ternyata seseorang telah mengenali dan mengimani Mesiah Universal yang salah, maka artinya yang bersangkutan tidak berhasil lulus dari ujian Allah SWT, dan sebagai akibatnya yang bersangkutan tidak akan memperoleh keselamatan dan keberkatan pada kehidupan di dunia dan di akherat.

Tetapi sebaliknya, jika selama hidup di dunia ternyata seseorang telah mengenali dan mengimani Mesiah Universal yang benar, maka artinya yang bersangkutan berhasil lulus dari ujian Allah SWT, dan sebagai ganjarannya yang bersangkutan akan memperoleh keselamatan dan keberkatan pada kehidupan di dunia dan di akherat

Orang nasrani kemudian menganggap Nabi Isa as sebagai juru selamatnya dan menganggap Nabi Muhammad Saw sbg mesiah dan Nabi palsu. Tapi setelah diselidiki Nabi Isa as tidak memiliki ciri kesamaan apapun dgn Nabi Musa as.

Bukankah di Al-Quran dikatakan bahwa nama Nabi Muhammad tertulis di alkitab? Coba anda cari ga bakalan ada, dan itulah senjata nasrani. Tapi setelah di cek dalam alkitab bahasa Ibrani, ternyata ditemukan, tapi bukan dgn nama “Ahmad” namun dgn tulisan “HMD” atau “Hamda” yang artinya adalah terpuji. Tapi “Hamda” juga bisa berarti “barang yang indah”, bah terjemahan kedualah yang diambil dan dijadikan patokan alkitab, namun itulah kelemahan kita karena tidak ada bukti lain.

Oleh ahli sejarah kemudian ditelusuri kembali, dan ditemukan bahwa ciri2 yang sama seperti musa as ternyata ada pada diri nabi muhammad saw. dan umat nasrani ga berkutik ketika disodorkan bukti terebut.

Ingat bung, bukti2 di atas lah yang disembunyikan oleh bangsa israil pada masa kenabian Nabi Muhammad Saw, karena bukti itulah mereka hendak membunuh Nabi Muhammad Saw.

Tentu anda tahu hadits 12 imam, 12 khalifah, Hadits kedudukan Imam ‘Ali dalam kitab2 sunni, sekarang saya tanya siapa saja 12 imam/khalifah versi sunni?

Apabila mengikuti pandangan Golongan Suni, maka tentunya akan sulit meyakinkan umat beragama lainnya tentang keabsahan Nabi Muhammad SAW sebagai Sang Mesiah Universal, karena pandangan Golongan Suni menafikan (menolak) adanya kesamaan antara Nabi Muhammad SAW dengan Nabi Musa as, khususnya berkaitan dengan Aspek Kenabian Ke-6 s/d Ke-9.

nih bukti2 hadits 12 imam dari kitab2 sunni yang ditolak oleh sunni sendiri :

Rasulullah saw bersabda, “Siapa yang ingin hidup seperti hidupku dan wafat seperti wafatku serta masuk ke surga yang telah dijanjikan kepadaku oleh Tuhanku yaitu Jannatul Khuld, maka hendaklah berwilayah kepada Ali dan keturunan sesudahnya, karena sesungguhnya mereka tidak akan mengeluarkan kamu dari pintu petunjuk dan tidak akan memasukkan kamu ke pintu kesesatan” (Referensi Sahih Ahlussunnah : Sahih Bukhari juz 5, Sahih Muslim juz 2; Adzahabi dalam kitabnya Mizanul I’tidal juz 4; Al-Khawarizmi dalam kitabnya Al-Manaqib, Al-Qunduzi Al-Hanafi dalam kitabnya Yanabi’ al-Mawaddah; Ibnu Hajar Asqalani as-Syafi’i dalam kitabnya Al-Ishabah juz 1)

Rasulullah saw bersabda, “Wahai manusia! Hormatilah Ali karena Allah telah mengkaruniakan kelebihan kepadanya. Terimalah Ali karena Allah telah melantiknya untuk kalian. Wahai manusia! Sesungguhnya Ali adalah imam dari Allah. Allah sekali-kali tidak akan menerima taubat seorang yang mengingkari wilayahnya. Dan Allah sekali-kali tidak akan mengampuninya. Sudah pasti Allah akan melakukan hal demikian ini terhadap orang yang menyalahi perintah-Nya mengenainya. Dan Dia akan menyiksanya dengan siksaan pedih yang berpanjangan. Lantaran itu kalian berhati-hatilah supaya kalian tidak menyalahinya. Justru itu kalian akan dibakar di neraka di mana bahan bakarnya adalah manusia dan batu disediakan kepada orang-orang yang ingkar” (Referensi Sahih Ahlussunnah : Al-Qunduzi al-Hanafi dalam kitabnya Yanabi` al-Mawaddah; al-Khawarizmi dalam kitabnya al-Manaqib; Ibnu Hajar dalam kitabnya Tahdhib al-Tahdhib juz 1)

Rasulullah saw bersabda, “Wahai manusia! Dengan akulah demi Allah, para Nabi dan Rasul yang terdahulu diberi khabar gembira. Aku adalah penutup para Nabi dan Rasul. Akulah hujjah atas semua makhluk di bumi dan di langit. Barangsiapa yang meragukan Ali adalah kafir sebagaimana kafir jahiliyah. Dan barangsiapa yang meragukan sabdaku ini, berarti dia meragukan seluruhnya. Orang yang meragukannya adalah neraka sebagai balasannya” (Referensi Sahih Ahlussunnah : Al-Qunduzi al-Hanafi dalam kitabnya Yanabi’ al-Mawaddah; al-Hakim dalam kitabnya al-Mustadrak juz 3)

Rasulullah saw bersabda, “Ali adalah pemimpin setiap orang yang beriman sesudahku” (Referensi Sahih Ahlussunnah : Sahih Tirmidzi, juz 5; Al-Qunduzi al-Hanafi dalam kitabnya Yanabi’ al-mawaddah; Al-Khawarizmi al-Hanafi dalam kitabnya Al-Manaqib; Ibnu Hajar dalam kitabnya Al-Ishabah juz 2; An-Nasa’i As-Syafi’i dalam kitabnya Khashaish Amirul Mukminin; Ibnu Asakir as-Syafi’i dalam kitabnya Tarjamah Ali bin Abi Thalib dalam Tarikh Damsyiq juz 1; Ibnu Atsir dalam kitabnya Jami’ al-Ushul juz 9)

Rasulullah saw bersabda, “Barangsiapa yang mati tanpa ketaatan (kepada seorang imam), mati sebagai murtad dan kafir.” (Referensi Sahih Ahlussunnah : Ahmad ibn Hanbal dalam kitabnya Musnad Ahmad, juz 3)

“Barangsiapa yang mati tanpa berbaiat (terhadap seorang imam), maka ia mati sebagai kafir.” (Referensi Sahih Ahlussunnah : Sahih Muslim)

“Barangsiapa mati dan tidak memiliki seorang imam, ia mati sebagai seorang kafir.” (Referensi Sahih Ahlussunnah : Al-Mu’jam al-Kabir juz 10)

“Selama masih ada paling sedikit dua orang (di dunia), persoalan ini (kekhalifahan) tetap berada di tangan Quraisy.” (Referensi Sahih Ahlussunnah : Sahih Muslim, Sahih Bukhari, Musnad Ahmad)

“Barangsiapa yang mati tanpa seorang imam, maka ia mati sebagai kafir.” (Referensi Sahih Ahlussunnah : Musnad Ahmad juz 4)

“Barangsiapa yang mati tidak memiliki imam umatnya, maka ia mati sebagai seorang kafir.” (Referensi Sahih Ahlussunnah : Al-Hakim dalam kitabnya Mustadrak juz 1)
Dari Ali mengatakan bahwa Rasulullah saw ketika menafsirkan ayat al-Qur’an, ‘(ingatlah) suatu hari ketika Kami memanggil setiap orang dengan imamnya’ (QS.Al-Isra:71) beliau bersabda, ‘Setiap kelompok akan dipanggil dengan imam zamannya.” (Referensi Sahih Ahlussunnah : Ad-Durr al-Mantsur juz 4; AL-Qurthubi dalam kitabnya Tafsir)

Jabir berkata, “Aku mendengar Rasulullah saw bersabda, ‘Akan ada 12 pemimpin dan khalifah.’ Kemudian beliau menambahkan sesuatu yang tidak bisa kudengar. Ayahku berkata bahwa Rasulullah saw bersabda, ‘Semuanya dari golongan Quraisy.’” (Referensi Sahih Ahlussunnah : Sahih Bukhari juz 4; Sahih Muslim; Sahih Tirmidzi; Sunan Abu Dawud; Musnad Ahmad)

Jabir meriwayatkan, “Aku dan ayahku pergi menemui Rasulullah saw. Kami mendengarnya bersabda, ‘Persoalan ini (kekhalifahan) tidak akan berakhir sampai datang 12 khalifah.’ Kemudian beliau menambahkan sesuatu yang tidak kudengar aku menanyakan pada ayahku apa yang Rasulullah saw sabdakan. Beliau saw bersabda, ‘Semuanya dari golongan Quraisy.’” (Referensi Sahih Ahlussunnah : Sahih Muslim)
Rasulullah saw bersabda, “Agama Islam akan tetap berdiri sampai 12 khalifah, yang semuanya dari golongan Quraisy, memerintah atas kamu.” (Referensi Sahih Ahlussunnah : Sahih Muslim; Syarah Nawawi)

Jabir berkata, “Rasulullah saw bersabda, ‘Akan ada 12 imam dan pemimpin setelahku.” Kemudian beliau mengatakan sesuatu yang tak dapat kumengerti. Aku menanyakan pada seseorang di sampingku tentang itu. Ia berkata, “Semuanya dari golongan Quraisy’” (Referensi Sahih Ahlussunnah : Sahih At-Tirmidzi juz 2)
Rasulullah saw bersabda, “Terdapat 12 khalifah untuk umat (Islam) ini.” (Referensi Sahih Ahlussunnah : Musnad Ahmad juz 5)

Rasulullah saw bersabda, “Agama ini akan tetap agung sampai datang 12 imam.” Mendengar hal ini, orang-orang mengagungkan Allah dengan berkata Allahu Akbar dan menangis keras. Kemudian beliau saw mengatakan sesuatu dengan suara yang pelan. “Aku bertanya pada ayahku, ‘Apa yang beliau katakan?’ ‘Mereka semua dari golongan Quraisy,’ jawabnya.’” (Referensi Sahih Ahlussunnah : Sahih Abu Dawud juz 2)

Awn mengutip ayahnya Abu Juhayfah sebagai berikut, “Aku dan pamanku sedang bersama Rasulullah saw, ketika itu beliau bersabda, “Urusan umatku akan terus berlalu sampai datang 12 khalifah.’ Kemudian beliau memelankan suaranya. Aku bertanya oleh Rasulullah saw. Ia menjawab, ‘Wahai anakku!’ Rasulullah saw bersabda bahwa mereka semua dari golongan Quraisy’” (Referensi Sahih Ahlussunnah : Mustadrak ‘ala ash-Shahihayn juz 3)

Masyruq berkata, “Kami duduk dengan Abdullah bin Mas’ud, mempelajari al-Qur’an darinya. Seseorang bertanya padanya, ‘Apakah engkau menanyakan kepada Rasulullah saw berapa khalifah yang akan memerintah umat ini?’ Ibnu Mas’ud menjawab, ‘Tentu saja kami menanyakan hal ini kepada Rasulullah saw dan beliau menjawab, ’12, seperti jumlah pemimpin suku Bani Israil.’” (Referensi Sahih Ahlussunnah : Musnad Ahmad juz 1)

Jabir meriwayatkan, “Aku dan ayahku sedang berhadapan dengan Rasulullah saw ketika beliau bersabda, ‘Pemerintahan dan khalifah umat islam ini akan berjumlah 12. mereka tidak akan menderita meskipun orang-orang tidak memberikan pertolongan.’ Dan menambahkan sesuatu yang tidak kudengar. Aku menanyakan pada ayahku tentang hal itu, ‘Rasulullah saw mengatakan bahwa mereka semua dari golongan Quraisy,’ jawabnya’” (Referensi Sahih Ahlussunnah : Al-Mu’jam Al-Kabir oleh Thabrani juz 2)

.
Dalil 12 Imam adalah Dari Bani Hasyim

Hadis-hadis tentang 12 imam adalah sahih dan mutawatir, mereka semua dari golongan Quraisy. Sekarang dari bani apakah mereka?

Jabir berkata, “Aku dan ayahku berada di hadapan Rasulullah saw ketika beliau bersabda, ‘Akan ada 12 khalifah setelahku.’ Kemudian beliau memelankan suaranya. Aku bertanya pada ayahku apa yang dikatakan oleh Rasulullah saw dengan pelan. Ia menjawab bahwa Rasulullah saw bersabda, ‘Mereka semua berasal dari Bani Hasyim!’” (Referensi Sahih Ahlussunnah : Al-Qunduzi Al-Hanafi dalam kitabnya Yanabi’ Al-Mawaddah, Maktabah Ibnu Taymiyah)

Siapakah 12 Imam Itu?

Siapakah mereka (Imam 12)? Keluarga suci (Ahlulbait) Nabi? Sahabat Nabi? Berikut ini adalah dalil-dalil Sahihnya dari kitab-kitab Ahlussunnah.

Dari Ibnu Abbas, “Rasulullah saw bersabda, ‘Barangsiapa ingin hidup dan mati sepertiku dan ditempatkan di surga ‘Adn yang diciptakan Allah, maka harus mengikuti Ali dan penerusnya dan para imam setelahku, karena mereka adalah Ahlulbaitku. Mereka diciptakan dari tanahku dan diberikan pengetahuan. Kesengsaraan bagi orang yang menolak derajat ketinggian mereka. Kesengsaraan bagi orang yang menolak hubungan mereka dengaku. Semoga Allah mencabutnya dari syafaat mereka’” (Referensi Sahih Ahlussunnah : Hilyat Al-Awliya juz 1)

Abu Sa’id al-Khudri berkata, “Rasulullah saw menyelesaikan shalat yang pertama bersama kami, kemudian membalik badan menghadap kami dan bersabda, ‘Wahai para sahabatku, Ahlulbaitku di sisimu adalahseperti perahu Nuh dan gerbang Tobat. Maka setelahku, berpegang teguhlah pada Ahlulbaiku, pengikut kebenaran dan keturunanku. Dan pasti kalian tidak akan tersesat’ beliau di tanya,’Wahai Rasulullah, ada berapa jumlah imam setelahmu?’ Beliau menjawab, ‘Mereka berjumlah 12 dari Ahlulbaitku’” (Referensi Sahih Ahlussunnah : HR. Al-Hakim dalam kitabnya Al-Mustadrak Ash-Shahihain, juz 2, Al-Hakim berkata hadits ini Sahih; Musnad al-Firdaus)

Seorang Yahudi memanggil Na’tsal untuk datang menemui Rasulullah saw dan berkata, “Wahai Muhammad! Aku memiliki beberapa pertanyaan yang telah lama kusimpan. Jika engkau dapat menjawabnya, maka aku akan mameluk Islam dengan pertolonganmu.” Rasulullah saw bersabda, “Wahai Abu Amarah! Engkau dapat menanyakannya padaku!” Ia bertanya, “Wahai Muhammad! Bertahukanlah kepadaku penerus-penerusmu, karena tidak ada Rasul tanpa penerus.” Rasulullah saw menjawab, “Penerusku adalah Ali bin Abi Thalib dan setelahnya adalah kedua cucuku Al-Hasan dan Al-Husain, yang setelahnya akan ada 9 imam dari keturunan al-Husain yang datang secara berurutan.” Kemudian Yahudi itu berkata, “Sebutkan nama-nama mereka, wahai Muhammad!” Rasulullah saw menyatakan, “Setelah al-Husain akan ada putranya Ali (Zainal Abidin), setelahnya Muhammad (Al-Baqir), setelahnya Ja’far (Ash-Shadiq), setelahnya Musa (Al-Kazhim), setelahnya Ali (Ar-Ridha), setelahnya Muhammad (Al-Jawad) setelahnya Ali (Al-Hadi), setelahnya Hasan (Al-Asykari) dan setelah Hasan putranya Hujjah Muhammad Al-Mahdi. Maka jumlah mereka ada 12 imam.” (Referensi Sahih Ahlussunnah : Al-Qunduzi al-Hanafi dalam kitabnya Yanabi’ al-Mawaddah)

PERLU DIGARIS BAWAHI SEMUA ITU ADALAH HADITS DARI KITAB-KITAB SUNNI, sampai dimana lagi kalian mau menolaknya?

Selamat menempuh ujian Allah SWT !!!

 

Kedudukan Hadis Umat Mengkhianati Ali Sepeninggal Nabi SAW

Rasulullah SAW telah mengabarkan kepada Imam Ali bahwa sepeninggal Beliau SAW, umat akan mengkhianati Imam Ali. Hal ini telah dinyatakan dalam hadis-hadis shahih. Salah satunya dalam hadis berikut

حدثنا أبو حفص عمر بن أحمد الجمحي بمكة ثنا علي بن عبد العزيز ثنا عمرو بن عون ثنا هشيم عن إسماعيل بن سالم عن أبي إدريس الأودي عن علي رضى الله تعالى عنه قال إن مما عهد إلي النبي صلى الله عليه وسلم أن الأمة ستغدر بي بعده

Telah menceritakan kepada kami Abu Hafsh Umar bin Ahmad Al Jumahi di Makkah yang berkata telah menceritakan kepada kami Ali bin Abdul Aziz yang berkata telah menceritakan kepada kami Amru bin ‘Aun yang berkata telah menceritakan kepada kami Husyaim dari Ismail bin Salim dari Abi Idris Al Awdi dari Ali Radhiyallahu ‘anhu yang berkata “Diantara yang dijanjikan Nabi SAW kepadaku bahwa Umat akan mengkhianatiku sepeninggal Beliau”. [Hadis riwayat Al Hakim dalam Al Mustadrak 3/150 no 4676 dishahihkan oleh Al Hakim dan Adz Dzahabi dalam At Talkhis]

Hadis ini adalah hadis yang shahih sebagaimana yang dikatakan oleh Al Hakim dan Adz Dzahabi. Selain itu hadis ini juga diriwayatkan oleh Ad Dulabi dalam Al Kuna Wal Asmaa’ 2/442 no 441

حدثنا يحيى بن غيلان ، عن أبي عوانة ، عن إسماعيل بن سالم ، وحدثنا فهد بن عوف ، قال ، ثنا أبو عوانة ، عن إسماعيل بن سالم ، عن أبي إدريس إبراهيم بن أبي حديد الأودي أن علي بن أبي طالب ، قال : عهد إلي النبي صلى الله عليه وسلم أن الأمة ستغدر بي من بعده

Telah menceritakan kepada kami Yahya bin Ghailan dari Abu ‘Awanah dari Ismail bin Salim dan telah menceritakan kepada kami Fahd bin Auf yang berkata telah menceritakan kepada kami Abu ‘Awanah dari Ismail bin Salim dari Abi Idris Ibrahim bin Abi Hadid Al Awdi bahwa Ali bin Abi Thalib berkata “telah dijanjikan oleh Nabi SAW bahwa Umat akan mengkhianatiku sepeninggal Beliau”.

Hadis ini sanadnya shahih dan diriwayatkan oleh para perawi yang terpercaya yaitu sanad Yahya bin Ghailan dari Abu Awanah dari Ismail bin Salim dari Ibrahim bin Abi Hadid dari Ali. Ibrahim adalah seorang tabiin yang melihat atau bertemu dengan Ali.

  • Yahya bin Ghailan dia adalah perawi Muslim Nasa’i dan Tirmidzi. Ibnu Hajar menyebutkan biografinya dalam At Tahdzib juz 11 no 429 dan ia telah dinyatakan tsiqat oleh Ibnu Sahl, Al Khatib, Ibnu Hibban, dan Ibnu Sa’ad. Ibnu Hajar dalam At Taqrib 2/312 menyatakan ia tsiqat.
  • Abu ‘Awanah dia adalah Wadhdhah bin Abdullah Al Yasykuri perawi Bukhari Muslim dan Ashabus Sunan. Ibnu Hajar menyebutkan biografinya dalam At Tahdzib juz 11 no 204 dan ia telah dinyatakan tsiqat oleh Abu Hatim, Abu Zar’ah, Ahmad, Ibnu Hibban, Ibnu Sa’ad dan Ibnu Abdil Bar. Dalam At Taqrib 2/283 ia dinyatakan tsiqat . Adz Dzahabi dalam Al Kasyf no 6049 juga mengatakan ia tsiqah.
  • Ismail bin Salim adalah perawi Bukhari dalam Adabul Mufrad, Muslim, Abu Dawud dan An Nasa’i. Ibnu Hajar dalam At Tahdzib juz 1 no 554 menyebutkan bahwa ia dinyatakan tsiqat oleh Ibnu Sa’ad, Ahmad, Abu Hatim, Abu Zar’ah, Daruquthni, Yaqub Al Fasawi, Abu Ali Al Hafiz dan Ibnu Hibban. Dalam At Taqrib 1/94 ia dinyatakan tsiqat.
  • Ibrahim bin Abi Hadid dia adalah seorang tabiin yang tsiqah. Ibnu Hibban memasukkannya dalam Ats Tsiqat juz 4 no 1613. Al Bukhari dalam Tarikh Al Kabir juz 1 no 908 menyebutkan keterangan tentangnya bahwa telah meriwayatkan darinya Ismail bin Salim tanpa menyebutkan jarh terhadapnya. Sehingga Ibrahim bin Abi Hadid adalah tabiin yang tsiqah dan Al Bukhari juga menyebutkan kalau ia bertemu atau melihat Ali bin Abi Thalib RA.

Jadi hadis riwayat Ad Dulabi dalam Al Kuna adalah hadis yang shahih. Sebelum mengakhiri tulisan ini kami akan membantah syubhat kalau Ibrahim bin Abi Hadid itu majhul dan hadisnya dari Ali mursal.

.

.

Syubhat Abu Hatim

Abu Hatim dalam Al Jarh Wat Ta’dil 2/96 menyebutkan kalau riwayat Ibrahim bin Abi Hadid dari Ali mursal dan ia seorang yang majhul. Pernyataan ini tertolak dengan dasar ulama-ulama lain mengenalnya seperti Ibnu Hibban, Al Bukhari dan Ibnu Ma’in. Dalam Tarikh Ibnu Ma’in no 1861 riwayat ad Dawri berkata

سمعت يحيى يقول أبو إدريس إبراهيم بن أبى حديد قلت ليحيى هو الذي يروى عنه إسماعيل بن سالم قال نعم

Aku mendengar Yahya mengatakan Abu Idris Ibrahim bin Abi Hadid. Aku bertanya kepada Yahya “diakah yang telah meriwayatkan darinya Ismail bin Salim”. Ia menjawab “ benar”.

Kemudian juga disebutkan dalam Tarikh Ibnu Ma’in no 2547 dari Ad Dawri

سمعت يحيى يقول أبو إدريس إبراهيم بن أبي حديد صاحب إسماعيل بن سالم

Aku mendengar Yahya mengatakan Abu Idris Ibrahim bin Abi Hadid sahabat Ismail bin Salim.

Pernyataan Abu Hatim bahwa riwayat Ibrahim bin Abi Hadid dari Ali mursal adalah pernyataan keliru dan itu didasari oleh ketidaktahuannya akan siapa Ibrahim bin Abi Hadid. Al Bukhari berkata dalam Tarikh Al Kabir juz 1 no 908

قال لي بن زرارة أخبرنا هشيم قال حدثنا إسماعيل بن سالم عن أبي إدريس نظرت إلى علي

Telah berkata kepadaku Ibnu Zurarah yang mengabarkan kepada kami Husyaim yang menceritakan kepada kami Ismail bin Salim bahwa Abu Idris melihat Ali.

Atsar ini shahih. Ibnu Zurarah adalah Syaikh(guru) Bukhari dan telah dinyatakan dalam At Taqrib 1/735 bahwa ia tsiqat dan Husyaim bin Basyir disebutkan dalam At Taqrib 2/269 kalau ia tsiqat tsabit. Sedangkan Ismail bin Salim telah disebutkan ketsiqahannya. Riwayat Bukhari ini sebaik-baik bukti yang membantah pernyataan Abu Hatim.

Selain diriwayatkan oleh Ibrahim bin Abi Hadid, hadis tersebut juga diriwayatkan oleh Tsa’labah bin Yazid Al Himmani. Hadis Tsa’labah diriwayatkan dalam Tarikh Dimasyq Ibnu Asakir 42/447, Musnad Al Bazzar 3/91, Dalail Nubuwwah Baihaqi 7/312 no 2759 dan Al Kamil Ibnu Ady 6/216. Berikut sanad hadis Tsa’labah bin Yazid yang terdapat dalam kitab Al Mathalib Al Aliyah Ibnu Hajar 11/205 no 4018

حدثنا الفضل هو أبو نعيم ثنا فطر بن خليفة أخبرني حبيب بن أبي ثابت قال سمعت ثعلبة بن يزيد قال سمعت عليا يقول والله إنه لعهد النبي الأمي صلى الله عليه وسلم

Telah menceritakan kepada kami Fadhl (dia Abu Nu’aim) yang berkata telah menceritakan kepada kami Fithr bin Khalifah yang berkata telah mengabarkan kepadaku Habib bin Abi Tsabit yang berkata aku mendengar Tsa’labah bin Yazid berkata aku mendengar Ali mengatakan Demi Allah, sesungguhnya Nabi yang ummi telah menjanjikan kepadaku.

Sanad ini adalah sanad yang shahih dan tidak diragukan keshahihannya, kecuali oleh mereka yang tidak senang dengan matan hadis tersebut.

  • Fadhl bin Dukain atau Abu Nu’aim adalah perawi Bukhari Muslim dan Ashabus Sunan yang dikenal tsiqah. Ibnu Hajar dalam At Tahdzib juz 8 no 505 menyebutkan bahwa ia dinyatakan tsiqat oleh Ahmad, Yaqub bin Syaibah, Ibnu Sa’ad, Ibnu Syahin Abu Hatim dan yang lainnya. Dalam At Taqrib 2/11 Ibnu Hajar menyatakan ia tsiqat.
  • Fithr bin Khalifah adalah perawi Bukhari dan Ashabus Sunan. Ibnu Hajar dalam At Tahdzib juz 8 no 550 menyebutkan bahwa ia dinyatakan tsiqat oleh Ahmad bin Hanbal, Yahya bin Sa’id, Ibnu Ma’in, Ibnu Sa’ad, Al Ajli, Nasa’i, dan Ibnu Hibban. Dalam At Taqrib 2/16 Ibnu Hajar menyatakan ia shaduq (jujur).
  • Habib bin Abi Tsabit adalah perawi Bukhari Muslim dan Ashabus Sunan. Ibnu Hajar dalam At Tahdzib juz 2 no 323 menyebutkan kalau ia dinyatakan tsiqat oleh Al Ajli, An Nasa’i, Abu Hatim, Ibnu Ma’in, Ibnu Hibban,  dan Ibnu Ady. Dalam At Taqrib 1/183 ia dinyatakan tsiqat.
  • Tsa’labah bin Yazid adalah seorang tabiin yang tsiqat. Ibnu Hajar dalam At Tahdzib juz 2 no 42 menyebutkan bahwa ia dinyatakan tsiqat oleh An Nasa’i dan Ibnu Hibban memasukkannya dalam Ats Tsiqat. Al Bukhari berkata bahwa hadis-hadisnya perlu diteliti lagi dan tidak diikuti. Pernyataan Bukhari tidaklah benar, hadis Tsa’labah bin Yazid ini ternyata diikuti oleh yang lainnya yaitu oleh Ibrahim bin Abi Hadid dan Hayyan Al Asdi, mereka semua meriwayatkan dari Ali RA.  Ibnu Ady mengakui kalau Tsa’labah tidak memiliki hadis-hadis mungkar. Ibnu Hajar dalam At Taqrib 1/149 menyatakan ia seorang syiah yang shaduq.

Sekali lagi kami katakan hadis ini shahih dan tidak ada gunanya syubhat yang dilontarkan oleh sebagian orang. Diantara mereka, ada yang berhujjah dengan pernyataan Al Bukhari dalam Tarikh Al Kabir juz 2 no 2103 biografi Tsa’labah bin Yazid dimana Bukhari berkata “perlu diteliti lagi” kemudian Al Bukhari membawakan hadis Tsa’labah ini dan berkata “tidak diikuti”. Kami sudah katakan bahwa Al Bukhari tidaklah benar, hadis ini diikuti oleh yang lain yaitu Ibrahim bin Abi Hadid dan Hayyan Al Asdi.

Ibnu Hibban ternyata memuat biografi Tsa’labah bin Yazid dalam Al Majruhin no 170 dan mengatakan bahwa ia berlebihan dalam tasyayyu’ tidak bisa dijadikan hujjah jika menyendiri meriwayatkan dari Ali. Kami katakan pencacatan karena tasyayyu’ tidaklah diterima dan Ibnu Hibban sendiri memasukkan Tsa’labah bin Yazid sebagai perawi tsiqah dalam Ats Tsiqat juz 4 no 1995 ditambah lagi Tsa’labah tidak menyendiri meriwayatkan hadis ini.

Semua syubhat tersebut sangat lemah dan telah dijelaskan kekeliruannya tetapi mereka salafiyun tetap tidak rela kalau hadis ini dikatakan shahih. Padahal jika diteliti dengan standar ilmu hadis yang benar maka tidak diragukan lagi bahwa hadis ini bersanad shahih. Wallahu’alam

 

Setelah kaum muslimin menyalati jenazah Nabi saw., Imam Ali as. menggali kuburan untuknya. Setelah itu, ia menguburkan jenazah sau-daranya itu.Kekuatan Ali telah melemah. Ia berdiri di pinggiran kubur sembari menutupi kuburan itu dengan tanah dengan disertai linangan air mata. Ia mengeluh: “Sesungguhnya sabar itu indah, kecuali terhadapmu. Sesung-guhnya berkeluh-kesah itu buruk, kecuali atas dirimu. Sesungguhnya musibah atasmu sangat besar. Dan sesungguhnya sebelum dan sesudah-mu terdapat peristiwa besar.”[1] 

Pada hari bersejarah itu, bendera keadilan telah terlipat di alam kesedihan, tonggak-tonggak kebenaran telah roboh, dan cahaya yang telah menyinari alam telah lenyap. Beliaulah yang telah berhasil meng-ubah perjalanan hidup umat manusia dari kezaliman yang gelap gulita kepada kehidupan sejahtera yang penuh dengan peradAbân dan keadilan. Dalam kehidupan ini, suara para tiran musnah dan jeritan orang-orang jelata mendapat perhatian. Seluruh karunia Allah terhampar luas untuk hamba-hamba-Nya dan tak seorang pun memiliki kesempatan untuk menimbun harta untuk kepentingannya sendiri.

Muktamar Tsaqîfah

Dalam sejarah dunia Islam, muslimin tidak pernah menghadapi tragedi yang sangat berat sebagai cobaan dalam kehidupan mereka seberat peris-tiwa Tsaqîfah yang telah menyulut api fitnah di antara mereka sekaligus membuka pintu kehancuran bagi kehidupan mereka.

Kaum Anshar telah melangsungkan muktamar di Tsaqîfah Bani Sâ‘idah pada hari Nabi saw. wafat. Muktamar itu dihadiri oleh dua kubu, suku Aus dan Khazraj. Mereka berusaha mengatur siasat supaya kekha-lifahan tidak keluar dari kalangan mereka. Mereka tidak ingin muktamar tersebut diikuti oleh kaum Muhajirin yang secara terus terang telah menolak untuk membaiat Imam Ali as. yang telah dikukuhkan oleh Nabi saw. sebagai khalifah dan pemimpin umat pada peristiwa Ghadir Khum. Mereka tidak ingin bila kenabian dan kekhalifahan berkumpul di satu rumah, sebagaimana sebagian pembesar mereka juga pernah menentang Nabi saw. untuk menulis wasiat berkenaan dengan hak Ali as. Ketika itu mereka melontarkan tuduhan bahwa Nabi saw. sedang mengigau sehing-ga mereka pun berhasil melakukan makar tersebut.

Ala kulli hal, kaum Anshar telah berperan sebagai tulang punggung bagi kekuatan bersenjata pasukan Nabi saw. dan mereka pernah mene-barkan kesedihan dan duka di rumah-rumah kaum Quraisy yang kala itu hendak melakukan perlawanan terhadap Rasulullah saw. Ketika itu orang-orang Quraisy betul-betul merasa dengki terhadap kaum Anshar. Oleh karena itu, kaum Anshar segera mengadakan muktamar, karena khawatir terhadap kaum Muhajirin.

Hubâb bin Munzdir berkata: “Kami betul-betul merasa khawatir bila kalian diperintah oleh orang-orang yang anak-anak, nenek moyang, dan saudara-saudara mereka telah kita bunuh.”[2]

Kekhawatiran Hubbâb itu ternyata menjadi kenyataan. Setelah usia pemerintahan para khalifah usai, dinasti Bani kaum Umayyah berkuasa. Mereka berusaha merendahkan dan menghinakan para khalifah itu. Mu‘âwiyah telah berbuat zalim dan kejam. Ketika Yazîd bin Mu‘âwiyah memerintah, dia juga bertindak sewenang-wenang dan menghancurkan kehormatan mereka dengan berbagai macam siksa dan kejahatan. Yazîd menghalalkan harta, darah, dan kehormatan mereka pada tragedi Harrah. Sejarah tidak pernah menyaksikan kekejian dan kekezaman semacam itu.

Ala kulli hal, pada muktamar Tsaqîfah tersebut, kaum Anshar men-calonkan Sa‘d sebagai khalifah, kecuali Khudhair bin Usaid, pemimpin suku Aus. Ia enggan berbaiat kepada Sa‘d karena kedengkian yang telah tertanam antara sukunya dan suku Sa‘d, Khazraj. Sudah sejak lama memang hubungan antara kedua suku ini tegang.

‘Uwaim bin Sâ‘idah bangkit bersama Ma‘n bin ‘Adî, sekutu Anshar, untuk menjumpai Abu Bakar dan Umar. Mereka ingin memberitahukan kepada dua sahabat ini peristiwa yang sedang berlangsung di Tsaqîfah. Abu Bakar dan Umar terkejut. Mereka segera pergi menuju ke Tsaqîfah secara tiba-tiba. Musnahlah seluruh cita-cita yang telah dirajut oleh kaum Anshar. Wajah Sa‘d berubah. Setelah terjadi pertikaian yang tajam antara Abu Bakar dan kaum Anshar, kelompok Abu Bakar segera bangkit untuk membaiatnya. Umar yang bertindak sebagai pahlawan dalam baiat itu telah memainkan peranannya yang aktif di ajang perebutan kekuasaan itu. Dia menggiring masyarakat untuk membaiat sahabatnya, Abu Bakar. Abu Bakar keluar dari Tsaqîfah diikuti oleh para pendukungnya menuju ke masjid Nabi saw. dengan diiringi oleh teriakan suara takbir dan tahlil. Dalam baiat ini, pendapat keluarga Nabi saw. tidak dihiraukan. Begitu pula pendapat para pemuka sahabatnya, seperti Ammâr bin Yâsir, Abu Dzar, Miqdâd, dan sahabat-sahabat yang lain.

Sikap Imam Ali as. Terhadap Pembaiatan Abu Bakar

Para sejarawan dan perawi hadis sepakat bahwa Imam Ali as. menolak dan tidak menerima pembaiatan atas Abu Bakar. Ia lebih berhak untuk menjadi khalifah. Karena beliaulah orang yang paling dekat dengan Nabi saw. Kedudukan Ali as. di sisi Nabi saw. seperti kedudukan Hârûn di sisi Mûsâ as. Islam telah tegak karena perjuangan dan keberaniannya. Dia mengalami berbagai macam bencana dalam menegakkan Islam. Nabi saw. menjadikan Ali as. sebagai saudaranya. Ia pernah bersabda kepada kaum muslimin: “Barang siapa yang aku adalah pemimpinnya, maka Ali adalah juga pemimpinnya.”

Atas dasar ini, Ali as. menolak untuk membaiat Abu Bakar. Abu Bakar dan Umar telah bersepakat untuk menyeret Ali as. dan memak-sanya berbaiat. Umar bin Khaththab bersama sekelompok pengikutnya mengepung rumah Ali as. Dia menakut-nakuti, mengancam, dan meng-gertak Ali as. dengan menggenggam api untuk membakar rumah wahyu itu. Buah hati Nabi saw. dan penghulu para wanita semesta alam keluar dan bertanya dengan suara lantang: “Hai anak Khaththab, apa yang kamu bawa itu?” Umar menjawab dengan keras: “Yang aku bawa ini lebih hebat daripada yang telah dibawa oleh ayahmu.”[3]

Sangat disayangkan dan menggoncang kalbu setiap orang muslim! Mereka telah berani bertindak keras seperti itu terhadap Fatimah Az-Zahrâ’ as., buah hati Nabi saw. Padahal Allah ridha karena keridhaan Az-Zahrâ’ dan murka karena kemurkaannya. Melihat kelancangan ini, tidak ada yang layak kita ucapkan selain innâ lillâh wa innâ ilaihi râji‘ûn.

Akhirnya, mereka memaksa Imam Ali as. keluar dari rumahnya dengan paksa. Dengan pedang terhunus para pendukung Khalifah Abu Bakar menyeret Imam Ali as. untuk menghadap. Mereka berkata dengan lantang: “Baiatlah Abu Bakar! Baiatlah Abu Bakar!”

Imam Ali as. membela diri dengan hujah yang kokoh tanpa rasa takut sedikit pun terhadap kekerasan dan kekuatan mereka. Ia berkata: “Aku lebih berhak atas perkara ini daripada kalian. Aku tidak akan membaiat kalian, sebaliknya kalianlah yang semestinya membaiatku. Kalian telah merampas hak ini dari kaum Anshar dengan alasan bahwa kalian memiliki hubungan kekerabatan dengan Nabi saw. Tetapi kalian juga telah merampas kekhalifahan itu dari kami Ahlul Bait secara paksa. Bukankah kalian telah mendakwa di hadapan kaum Anshar bahwa kalian lebih berhak atas kekhilafahan ini daripada mereka dengan dalih Nabi Muhammad saw. berasal dari kalangan kalian, sehingga mereka rela memberikan dan menyerahkan kepemimpinan itu kepadamu? Kini aku juga ingin berdalih kepadamu seperti kamu berdalih kepada kaum Anshar. Sesungguhnya aku adalah orang yang lebih utama dan lebih dekat dengan Nabi saw., baik ketika ia masih hidup maupun setelah wafat. Camkanlah ucapanku ini, jika kamu beriman! Jika tidak, maka kamu telah berbuat zalim sedang kamu menyadarinya.”

Betapa indah hujah dan dalil tersebut. Kaum Muhajirin dapat mengalahkan kaum Anshar lantaran hujah itu, karena mereka merasa memiliki hubungan kekerabatan yang sangat dekat dengan Nabi saw. Argumentasi Imam Ali as. lebih kuat, lantaran suku Quraisy yang terdiri dari banyak kabilah dan memiliki hubungan kekeluargaan dengan Nabi saw. itu bukan sepupu-sepupu atau pamannya. Sementara hubungan kekerabatan antara Nabi saw. dengan Imam Ali as. terjalin dalam bentuk yang paling sempurna. Ali as. adalah sepupu Nabi saw., ayah dua orang cucunya, dan suami untuk putri semata wayangnya.

Walau demikian, Umar tetap memaksa Imam Ali as. dan berkata: “Berbaiatlah!”

“Jika aku tidak melakukannya?”, tanya Imam Ali pendek.

“Demi Allah yang tiada tuhan selain Dia, jika engkau tidak mem-baiat, aku akan penggal lehermu”, jawab Umar sengit.

Imam Ali as. diam sejenak. Ia memandang ke arah kaum yang telah disesatkan oleh hawa nafsu dan dibutakan oleh cinta kekuasaan itu. Imam Ali as. melihat tidak ada orang yang akan menolong dan membe-lanya dari kejahatan mereka. Akhirnya ia menjawab dengan nada sedih: “Jika demikian, kamu telah membunuh hamba Allah dan saudara Rasu-lullah.”

Umar segera menimpali dengan berang: “Membunuh hamba Allah, ya. Tetapi saudara Rasulullah, tidak.”

Umar telah lupa dengan sabda Nabi saw. bahwa Imam Ali as. adalah saudaranya, pintu kota ilmunya, dan kedudukannya di sisinya adalah sama dengan kedudukan Hârûn di sisi Mûsâ as. Ali as. adalah pejuang pertama Islam. Semua realita dan keutamaan itu telah dilupakan dan diingkari oleh Umar.

Kemudian Umar menoleh ke arah Abu Bakar seraya menyuruhnya untuk mengingkari hal itu. Kepada Abu Bakar, Umar berkata: “Mengapa engkau tidak menggunakan kekuasaanmu untuk memaksanya?”

Abu Bakar takut fitnah dan hal-hal yang tidak diinginkan terjadi. Akhirnya dia menentukan sikap: “Aku tidak akan memaksanya, selama Fatimah berada di sisinya.”

Akhirnya mereka membebaskan Imam Ali as. Ia berlari menuju ke makam saudaranya, Nabi saw., untuk mengadukan cobaan dan aral yang sedang menimpanya. Ia menangis tersedu-sedu seraya berkata: “Wahai putra ibuku, sesungguhnya kaum ini telah meremehkanku dan hampir saja mereka membunuhku.”[4]

Mereka telah meremehkan Imam Ali as. dan mengingkari wasiat-wasiat Nabi saw. berkenaan dengan dirinya. Setelah itu ia kembali ke rumah dengan hati yang hancur luluh dan sedih. Benar, telah terjadi apa yang telah diberitakan oleh Allah swt. akan terjadi pada umat Islam setelah Rasulullah saw. wafat. Mereka kembali kepada kekufuran. Allah swt. berfirman:

Muhammad itu tidak lain hanyalah seorang rasul; sungguh telah berlalu sebelumnya beberapa orang rasul. Apakah jika ia wafat atau dibunuh, kamu berbalik ke belakang (murtad)? Barang siapa yang berbalik ke belakang, maka ia tidak dapat mendatangkan mudarat kepada Allah sedikit pun ….”(QS. Âli ‘Imrân [3]:144)

Sungguh mereka telah kembali kepada kekufuran, kekufuran yang dapat menghancurkan iman dan harapan-harapan mereka. Innâ lillâh wa innâ ilaihi râji‘ûn.

Kita tutup lembaran peristiwa-peristiwa yang mengenaskan dan segala kebijakan pemerintah Abu Bakar yang tiran terhadap keluarga Nabi saw. ini, seperti merampas tanah Fadak, menghapus khumus, dan kebijakan-kebijakan yang lain. Seluruh peristiwa ini telah kami jelaskan secara rinci dalam Mawsû‘ah Al-Imam Amiril Mukminin as.

Fatimah Az-Zahrâ’ Menuju ke Alam Baka

Salah satu peristiwa yang sangat menyedihkan Imam Ali as. adalah kepergian buah hati Rasulullah saw., Fatimah Az-Zahrâ’ as. Ia jatuh sakit, sementara hatinya yang lembut tengah merasakan kesedihan yang mendalam. Rasa sakit telah menyerangnya. Dan kematian begitu cepat menghampirinya, sementara usianya masih begitu muda. Oh, betapa beratnya duka yang menimpa buah hati dan putri semata wayang Nabisaw. itu. Ia telah mengalami berbagai kekejaman dan kezaliman dalam masa yang sangat singkat setelah ayahandanya wafat. Mereka telah mengingkari kedudukannya yang mulia di sisi Rasulullah, merampas hak warisannya dan menyerang rumahnya.

Fatimah Az-Zahrâ’ telah menyampaikan wasiat terakhir yang maha penting kepada putra pamannya. Dalam wasiat itu ditegaskan agar orang-orang yang telah ikut serta merampas haknya tidak boleh menghadiri pemakaman, jenazahnya dikuburkan pada malam hari yang gelap gulita, dan kuburannya disembunyikan agar menjadi bukti betapa ia murka kepada mereka.

Imam Ali as. melaksanakan wasiat istrinya yang setia itu di pusara-nya yang terakhir. Ia berdiri di pinggir makamnya sambil menyiramnya dengan tetesan-tetesan air mata. Ia menyampaikan ucapan takziah, bela sungkawa dan pengaduan kepada Nabi saw. setelah menyampaikan salam kepada beliau:

Salam sejahtera untukmu dariku, ya Rasulullah, dan dari putrimu yang telah tiba di haribaanmu dan yang begitu cepatnya menyusulmu. Ya Rasulullah, betapa sedikitnya kesabaranku dengan kemangkatanmu dan betapa beratnya hati ini. Hanya saja, dalam perpisahan denganmu dan besarnya musibahmu ada tempat untuk berduka. Aku telah membaring-kanmu di liang kuburmu. Dan jiwamu telah pergi meninggalkanku ketika kepalamu berada di antara leher dan dadaku. Innâ lillâh wa innâ ilaihi râji‘ûn. Titipan telah dikembalikan dan gadai pun telah diambil kembali. Tetapi kesedihanku tetap abadi. Malam-malamkupun menjadi panjang, hingga Allah memilihkan untukku tempatmu yang kini engkau singgahi. Putrimu akan bercerita kepadamu tentang persekong-kolan umatmu untuk berbuat kejahatan. Tanyakanlah dan mintalah berita mengenai keadan mereka! Padahal perjanjian itu masih hangat dan namamu masih disebut-sebut. Salam sejahtera atasmu berdua, salam selamat tinggal, tanpa lalai dan jenuh! Jika aku berpaling, itu bukan karena bosan. Jika aku diam, itu bukan karena aku berburuk sangka terhadap apa yang dijanjikan Allah kepada orang-orang yang sabar.[5]

Ungkapan-ungkapan Imam Ali as. di atas menunjukkan betapa ia menga-lami kesedihan yang mendalam atas kepergian titipan Rasulullah saw. itu. Ungkapan-ungkapan itu juga menunjukkan betapa dalamnya sakit hati dan duka yang dialaminya akibat perlakuan umat Islam. Imam Ali as. juga minta kepada Nabi saw. agar memaksa putrinya bercerita dan memberi-kan keterangan tentang seluruh kejahatan dan kezaliman yang telah dilakukan oleh umatnya itu.

Seusai menguburkan jenazah buah hati Nabi saw., Imam Ali as. kembali ke rumah dengan rasa duka dan kesedihan yang datang silih berganti. Para sahabat telah mengasingkannya. Imam Ali as. berpaling sebagaimana mereka juga berpaling darinya. Ia bertekad untuk menjauhi seluruh urusan politik dan tidak terlibat di dalamnya.


1.Nahjul Balaghah, khotbah ke-409.

2.Hayâh Al-Imam Husain as., Jil. 1/ 235.

3.Ansâb Al-Asyrâf, karya Al-Balâdzurî. Para sejarahwan sepakat tentang adanya ancaman Umar terhadap Ali as. untuk membakar rumahnya itu. Silakan merujuk Târîkh Ath-Thabarî, Jil. 3/202, Târikh Abi Al-Fidâ’, Jil. 1/156, Târîkh Al-Ya‘qûbî, Jil. 2/105, Murûj Adz-Dzahab, Jil. 1/414, Al-Imâmah wa As-Siyâsah, Jil. 1/12, Syarah Nahjul Balâghah, karya Ibn Abil Hadîd, Jil. 1/ 34, Al-Amwâl, karya Abu ‘Ubaidah, hal. 131, A‘lâm An-Nisâ’, Jil. 3/205, danAl-Imam Ali, karya Abul Fattâh Maqshûd, Jil. 1/213.

4.Al-Imâmah wa As-Siyâsah, hal. 28-31.

5.Nahjul Balâghah, Jil. 2/ 182.

.

Penjagaan Nabi SAW dan Imam Ali AS atas keberlanjutan AGAMA iSLAM adalah lebih penting daripada beliau menjaga para sahabat nya. Lagipula proyek pengkaderan telah menghasilkan tokoh tokoh revolusioner yang tangguh seperti Salman Al Farisi, Abu Dzar Al Ghifari, Ammar bin Yasir, Miqdad dll

.

Imam Ali as. menerangkan kepada kita sebab mengapa beliau pada akhirnya memberikan baiat untuk Abu Bakar dan tidak terus mengambil sikap oposisi, apalagi perlawanan bersenjata!

.
Dalam keterangan-keterangan yang dinukil dari Imam Ali as. ada beberapa sebab:
Pertama, tidak adanya pembela yang cukup untuk mengambil alih kembali hak kewalian beliau.
Sikap Imam Ali as. itu telah beliau abadikan dalam benyak kesempatan, di antara dalam pidato beliau yang terkenal dengan nama khuthbah Syiqsyiqiyyah
.
Imam Ali as. berpidato:
أَمَا وَاللهِ لَقَدْ تَقَمَّصَهَا إبْنُ اَبِيْ قُحَافَةَ وَإِنَّهُ لَيَعْلَمُ أَنَّ مَحَلِّي مِنْهَا مَحَلُّ اْلقُطْبِ مِنَ الْرُحَى , يَنْحَدِرُ عَنِّي اْلسَيْلُ وَ لاَ يَرْقَى إلَىَّ الْطَيْرُ. فَسَدَلْتُ دُوْنَهَا ثَوْبًا  وَ طَوَيْتُ عَنْهَا كَشْحًا . وَ طَفِقْتُ أَرْتَئِ بَيْنَ أنْ أَصُوْلَ بِيَدٍ جَذَّاءَ أوْ أَصْبِرَ عَلَى طِخْيةٍ عَمْيَاءَ , يَهْرَمُ فِيْهَا الْكَبِيْرُ وَ يَشِيْبُ فِيْهَا الْصَغِيْرُ, وَ يَكْدَحُ  فِيْهَا الْمُؤْمِنُ حَتَّى يَلْقَى رَبَّهُ !
فَرَاَيْتُ اَنَّ الْصَبْرَ عَلَى هَاتَا أَحْجَى . فَصَبَرْتُ , وَ فِي الْعَيْنِ قَذًى, و فِي الْحَلْقِ شَجًا أَرَى تُرَاثِيْ نَهْبًا.                                                           
“Demi Allah, sesungguhnya putra Abu Quhafah (Abu ABakar) telah mengenakan busana kekhilafahan itu, padahal ia tahu bahwa kedudukanku sehubungan dengan itu adalah bagaikan kedudukan poros pada penggiling. Air bah mengalir dariku dan burung tak dapat terbang sampai kepadaku. Maka aku mengulur tabir terhadap kekhilafahan dan melepaskan diri darinya. Kemudian aku mulai berpikir, apakah aku harus menyerang dengan tangan terputus atau bersabar atas kegelapan yang membutakan, dimana orang dewasa menjadi tua bangka dan anak kecil menjadi beruban dan orang mukmin yang sesungguhnya hidup dalam tekanan sampai ia menemui Tuhannya!
Maka aku dapati bahwa bersabar atasnya lebih bijaksana. Maka aku bersabar, walaupun ia menusuk mata dan mencekik kerongkongan. Aku menyaksikan warisanku dirampok … “ [1]
.
Kedua, sikap enggan memberikan baiat itu sudah cukup membuktikan hak kewalian beliau yang mereka bekukan
.
Dan ketiga, mengingat maslahat umat Islam menuntut agar beliau mengorbankan hak beliau demi meraih maslahat Islam yang lebih abadi. Sebab eksistenti kaum Muslimin dan Dawlah Islam sedang terancam dengan maraknya kaum murtad yang meninggalkan agama Islam dan berniat untuk menyerang kota suci Madinah dan memerangi kaum Muslim!
.
Dalam sebuah pernyataannya, Imam Ali as. menjelaskan sebab mengapa beliau sudi memberikan baiat untuk Abu Bakar:
فأَمْسَكْتُ يدي حتَّى رأيتُ راجِعَةَ الناسِ قد رجعت عن الإسلامِ , يدعون إلى مَحقِ دين محمد (ص), فَخَشيتُ إن لم أنصرِ الإسلامِ و أهلَه أن أرى فيه ثَلْمًا أو هدمًا تكون المصيبةُ بِهِ عليَّ أعظَم من فوتِ ولايَتِكم.
“Dan ketika aku saksikan kemurtadan orang-orang telah kembali meninggalkan Islam, mereka mengajak kepada pemusnahan agama Muhammad saw., maka aku khawatir jika aku tidak membela Islam dan para  pemeuluknya aku akan menyaksikan celah atau keruntuhan Islam yang bencananya atasku lebih besar dari sekedar hilangnya kekuasaan atas kalian.”[2]
.
Inilah sebabh hkiki dalam maalah ini, bukan seperti yang diasumsikan sebagian orang
.
Adapaun tuduhan Syeikh bahwa dengan demikian kaum Syi’ah menuduh Imam mereka bersikap pengecut, maka kesimpulan miring itu sama sekali tidak berdasar, sebab pada diri Nabi Harun as. terdapat uswah, teladah baik bagi Imam Ali as. ketika beliau berkata, seperti diabadikan dalam Al Qur’an:
وَ لَمَّا رَجَعَ مُوسى‏ إِلى‏ قَوْمِهِ غَضْبانَ أَسِفاً قالَ بِئْسَما خَلَفْتُمُوني‏ مِنْ بَعْدي أَ عَجِلْتُمْ أَمْرَ رَبِّكُمْ وَ أَلْقَى الْأَلْواحَ وَ أَخَذَ بِرَأْسِ أَخيهِ يَجُرُّهُ إِلَيْهِ قالَ ابْنَ أُمَّ إِنَّ الْقَوْمَ اسْتَضْعَفُوني‏ وَ كادُوا يَقْتُلُونَني‏ فَلا تُشْمِتْ بِيَ الْأَعْداءَ وَ لا تَجْعَلْني‏ مَعَ الْقَوْمِ الظَّالِمينَ 
“Dan tatkala Musa telah kembali kepada kaumnya dengan marah dan sedih hati berkatalah dia: “Alangkah buruknya perbuatan yang kamu kerjakan sesudah kepergianku! Apakah kamu hendak mendahului janji Tuhanmu?” Dan Musa pun melemparkan luh-luh (Taurat) itu dan memegang (rambut) kepala saudaranya (Harun) sambil menariknya ke arahnya. Harun berkata: “Hai anak ibuku, sesungguhnya kaum ini telah menganggapku lemah dan hampir-hampir mereka membunuhku, sebab itu janganlah kamu menjadikan musuh-musuh gembira melihatku, dan janganlah kamu masukkan aku ke dalam golongan orang-orang yang lalim.” (QS.A’râf [7];150) 
.
Imam Ali as. mengalami kondisi serupa dengan parnah dialami oleh Nabi Harun as. ketika kaumnya membangkang dengan kesesatan akibat provokasi Samiri
.
Ketertindasan dan ketidak-berdayaan Imam Ali as. itu telah diberitakan Nabi saw. dalam banyak sabda beliau, di antaranya adalah hadis yang sangat terkenal yang berbunyi:
أنتم المستَضْغَفٌون بَعدي
“Sepeninggalku, kalian akan ditindas.”[3]
.
Nabi saw. Mengabarkan Bahwa Umat Akan Mengkhianati Imam Ali as. 
Bahkan lebih dari itu, Nabi saw. telah memberitakan dari balik tirai ghaib, bahwa umat ini akan menelantarkan Ali as. dan tidak memberikan kesetian pembelaan untuknya. Mereka akan mengkhianatinya!
.
Imam Ali as. berulang kali mengatakan:
إنّه ممّا عهد إليّ النبي (صلى الله عليه وآله وسلم) أنّ الاُمّة ستغدر بي بعده.
 “Termasuk yang dijanjikan Nabi kepadaku bahwa umat akan mengkhianatiku sepeninggal beliau.” 
Hadis ini telah diriwayatkan dan dishahihkan al Hakim dan adz Dzahabi. Ia berkata:
صحيح الاسناد
“Hadis ini sahih sanadnya.”
.
Adz Dzahabi pun menshahihkannya. Ia berkata:
صحيح
“Hadis ini shahih.” [4]
Sebagaimana juga diriwayatkan oleh Ibnu Abi Syaibah, al Bazzâr, ad Dâruquthni, al Khathib al Baghdâdi, al Baihaqi dkk.
.
Nabi saw. Mengabarkan Bahwa Umat Akan Menuangkan Kedengkian Mereka Kepada Imam Ali as.
Demikian juga, sebagian orang yang memendam dendam kusumat dan kebencian kepada Nabi saw. akan menuangkannya kepada Imam Ali as., dan puncaknya akan mereka lakukan sepeninggal Nabi saw
.
Kenyataan itu telah diberitakan Nabi saw. kepada Ali as. Para ulama meriwayatkan banyak hadis tentangnya, di antaranya adalah hadis di bawah ini
:
Imam Ali as. berkata:
بينا رسول الله (صلى الله عليه وسلم) آخذ بيدي ونحن نمشي في بعض سكك المدينة، إذ أتينا على حديقة، فقلت: يا رسول الله ما أحسنها من حديقة ! فقال: إنّ لك في الجنّة أحسن منها، ثمّ مررنا بأُخرى فقلت: يا رسول الله ما أحسنها من حديقة ! قال: لك في الجنّة أحسن منها، حتّى مررنا بسبع حدائق، كلّ ذلك أقول ما أحسنها ويقول: لك في الجنّة أحسن منها، فلمّا خلا لي الطريق اعتنقني ثمّ أجهش باكياً، قلت: يا رسول الله ما يبكيك ؟ قال: ضغائن في صدور أقوام لا يبدونها لك إلاّ من بعدي، قال: قلت يا رسول الله في سلامة من ديني ؟ قال: في سلامة من دينك.
“Ketika Rasulullah saw. memegang tanganku, ketika itu kami sedang berjalan-jalan di sebagian kampong kota Madinah, kami mendatangi sebuah kebun, aku berkata, ‘Wahai Rasulullah alangkah indahnya kebun ini!’ Maka beliau bersabda, ‘Untukmu di surga lebih indah darinya.’ Kemudian kami melewati tujuh kebun, dan setiap kali aku mengatakannya, ‘Alangkah indahnya’ dan nabi pun bersabda, ‘Untukmu di surga lebih indah darinya.’ Maka ketika kami berda di tempat yang sepi, Nabi saw. memelukku dan sepontan menangis. Aku berkata, ‘Wahai Rrasulullah, gerangan apa yang menyebabkan Anda menangis?’ Beliau menjawab, ‘Kedengkian-kedengkian yang ada di dada-dada sebagian kaum yang tidak akan mereka tampakkan kecuali setelah kematianku.’ Aku berkata, ‘Apakah dalam keselamatan dalam agamaku?’ Beliau menjawab, ‘Ya. Dalam keselamatan agamamu.’”
Hadis ini diriwayatkan oleh Abu Ya’la, al Bazzâr dengan sanad shahih, al Hakim dan adz Dzahabi dan mereka menshahihkannya,[5] Ibnu Hibbân dkk. [6]
Ia juga disebutkan oleh asy Syablanji dalam kitab Nûr al Abshârnya:88
.
Jadi jelaslah bagi kita apa yang sedang dialami oleh Imam Ali as. dari sebagian umat ini!

Tahukah anda kaum sunni, dlm kitab anda yg paling sahih, tercatat bagaimana Umar meragukan kenabian Junjungan Nabi Muhammad saaw saat perjanjian Hudaibiyah? Dan anda memujinya dgn pelbagai gelaran dan kehebatan…

.

Nabi saw telah menubuwahkan  nasib yang bakal menimpa Imam Ali a.s selepas Baginda saw wafat nanti, seperti  hadis berikut:

1. Rasulullah SAW melalui lisan sucinya telah mengabarkan kepada Imam Ali, bagaimana kondisi Imam Ali sepeninggal Beliau SAW. Beliau saaw mengatakan bahwa Imam Ali akan mengalami kesukaran atau kesulitan sepeninggal Beliau SAW. Hal ini diriwayatkan dalam kabar shahih yang tercatat dalam kitab Al Mustadrak Al Hakim 3/151 no 4677
أخبرنا أحمد بن سهل الفقيه البخاري ثنا سهل بن المتوكل ثنا أحمد بن يونس ثنا محمد بن فضيل عن أبي حيان التيمي عن سعيد بن جبير عن ابن عباس رضي الله عنهما قال : قال النبي صلى الله عليه و سلم لعلي أما أنك ستلقى بعدي جهدا قال في سلامة من ديني ؟ قال : في سلامة من دينك

Telah mengabarkan kepada kami Ahmad bin Sahl seorang faqih dari Bukhara yang berkata telah menceritakan kepada kami Sahl bin Mutawwakil yang berkata telah menceritakan kepada kami Ahmad bin Yunus yang berkata telah menceritakan kepada kami Muhammad bin Fudhail dari Abi Hayyan At Taimi dari Sa’id bin Jubair dari Ibnu Abbas RA yang berkata Nabi saaw berkata kepada Ali “Sesungguhnya kamu akan mengalami kesukaran (bersusah payah) sepeninggalKu”. Ali bertanya “apakah dalam keselamatan agamaku?”. Nabi saaw menjawab “dalam keselamatan agamamu”

.

2. Rasulullah SAW telah mengabarkan kepada Imam Ali bahwa sepeninggal Beliau SAW, umat akan mengkhianati Imam Ali. Hal ini telah dinyatakan dalam hadis-hadis shahih. Salah satunya dalam hadis berikut
حدثنا أبو حفص عمر بن أحمد الجمحي بمكة ثنا علي بن عبد العزيز ثنا عمرو بن عون ثنا هشيم عن إسماعيل بن سالم عن أبي إدريس الأودي عن علي رضى الله تعالى عنه قال إن مما عهد إلي النبي صلى الله عليه وسلم أن الأمة ستغدر بي بعده
Telah menceritakan kepada kami Abu Hafsh Umar bin Ahmad Al Jumahi di Makkah yang berkata telah menceritakan kepada kami Ali bin Abdul Aziz yang berkata telah menceritakan kepada kami Amru bin ‘Aun yang berkata telah menceritakan kepada kami Husyaim dari Ismail bin Salim dari Abi Idris Al Awdi dari Ali Radhiyallahu ‘anhu yang berkata “Diantara yang dijanjikan Nabi SAW kepadaku bahwa Umat akan mengkhianatiku sepeninggal Beliau”. [Hadis riwayat Al Hakim dalam Al Mustadrak 3/150 no 4676 dishahihkan oleh Al Hakim dan Adz Dzahabi dalam At Talkhis]

.

Hadis ini adalah hadis yang shahih sebagaimana yang dikatakan oleh Al Hakim dan Adz Dzahabi. Selain itu hadis ini juga diriwayatkan oleh Ad Dulabi dalam Al Kuna Wal Asmaa’ 2/442 no 441

حدثنا يحيى بن غيلان ، عن أبي عوانة ، عن إسماعيل بن سالم ، وحدثنا فهد بن عوف ، قال ، ثنا أبو عوانة ، عن إسماعيل بن سالم ، عن أبي إدريس إبراهيم بن أبي حديد الأودي أن علي بن أبي طالب ، قال : عهد إلي النبي صلى الله عليه وسلم أن الأمة ستغدر بي من بعده
Telah menceritakan kepada kami Yahya bin Ghailan dari Abu ‘Awanah dari Ismail bin Salim dan telah menceritakan kepada kami Fahd bin Auf yang berkata telah menceritakan kepada kami Abu ‘Awanah dari Ismail bin Salim dari Abi Idris Ibrahim bin Abi Hadid Al Awdi bahwa Ali bin Abi Thalib berkata “telah dijanjikan oleh Nabi SAW bahwa Umat akan mengkhianatiku sepeninggal Beliau”

.

3. Selain diriwayatkan oleh Ibrahim bin Abi Hadid, hadis tersebut juga diriwayatkan oleh Tsa’labah bin Yazid Al Himmani. Hadis Tsa’labah diriwayatkan dalam Tarikh Dimasyq Ibnu Asakir 42/447, Musnad Al Bazzar 3/91, Dalail Nubuwwah Baihaqi 7/312 no 2759 dan Al Kamil Ibnu Ady 6/216. Berikut sanad hadis Tsa’labah bin Yazid yang terdapat dalam kitab Al Mathalib Al Aliyah Ibnu Hajar 11/205 no 4018
حدثنا الفضل هو أبو نعيم ثنا فطر بن خليفة أخبرني حبيب بن أبي ثابت قال سمعت ثعلبة بن يزيد قال سمعت عليا يقول والله إنه لعهد النبي الأمي صلى الله عليه وسلم
Telah menceritakan kepada kami Fadhl (dia Abu Nu’aim) yang berkata telah menceritakan kepada kami Fithr bin Khalifah yang berkata telah mengabarkan kepadaku Habib bin Abi Tsabit yang berkata aku mendengar Tsa’labah bin Yazid berkata aku mendengar Ali mengatakan Demi Allah, sesungguhnya Nabi yang ummi telah menjanjikan kepadaku….(sama spt teks dlm hadis di atas)

.

Dengan ini, maka Imam Ali a.s telah tahu dan bersedia menghadapi pengkhianatan umat ke atas beliau a.s…

Namun, utk mengatakan bahawa beliau tidak menyebutkan hak2 dan keutamaan beliau kpd umat, adalah suatu yg mengelirukan, karena beliau a.s dlm banyak kesempatan, telah menyebutkannya

.

Diriwayatkan dengan sanad yang shahih bahwa Imam Ali mengakui kalau dirinya adalah orang yang paling berhak dalam urusan kepemimpinan sepeninggal Nabi SAW. Tetapi walaupun begitu demi kemaslahatan umat islam, Beliau tetap pada akhirnya memberikan baiat kepada para khalifah yaitu Abu Bakar RA, Umar RA dan Utsman RA. Hal ini tentu saja bertujuan agar tidak terjadi perpecahan di kalangan kaum muslimin. Sebagian orang yang ingkar menjadikan baiat-nya Imam Ali sebagai alasan untuk membenarkan kepemimpinan ketiga khalifah. Sebaik-baik bantahan bagi mereka adalah pernyataan Imam Ali sendiri yang mengakui kalau ia adalah orang yang paling berhak sepeninggal Nabi SAW bukan Abu Bakar, bukan Umar dan bukan pula Utsman

.
حدثني روح بن عبد المؤمن عن أبي عوانة عن خالد الحذاء عن عبد الرحمن بن أبي بكرة أن علياً أتاهم عائداً فقال ما لقي أحد من هذه الأمة ما لقيت توفي رسول الله صلى الله عليه وسلم وأنا أحق الناس بهذا الأمر فبايع الناس أبا بكر فاستخلف عمر فبايعت ورضيت وسلمت ثم بايع الناس عثمان فبايعت وسلمت ورضيت وهم الآن يميلون بيني وبين معاوية
Telah menceritakan kepadaku Rawh bin Abdul Mu’min dari Abi Awanah dari Khalid Al Hadzdza’ dari Abdurrahman bin Abi Bakrah bahwa Ali mendatangi mereka dan berkata “Tidak ada satupun dari umat ini yang mengalami seperti yang saya alami. Rasulullah SAW wafat dan sayalah yang paling berhak dalam urusan ini . Kemudian orang-orang membaiat Abu Bakar terus Umar menggantikannya, maka akupun ikut membaiat, pasrah dan menerima. Kemudian orang-orangpun membaiat Utsman maka akupun ikut membaiat, pasrah dan menerima. Dan sekarang mereka bingung antara aku dan Muawiyah” [Ansab Al Asyraf Al Baladzuri 1/294]

.
Imam Ali as. Mengeluhkan Pengkhiatanan Suku Quraisy!
Dalam banyak pernyataannya, Imam Ali as. telah mengeluhkan kedengkian, kejahatan dan sikap arogan suku Quraisy terhadap Nabi saw. yang kemudian, ketika mereka tidak mendapatkan jalan untuk meluapkannya kepada beliau saw., mereka meluapkan dendanm kusumat kekafiran dan kemunafikan kepadanya as
.
Di bawah ini akan saya sebutkan sebuah kutipan pernyataan beliau as. tersebut.
اللهمّ إنّي أستعديك على قريش، فإنّهم أضمروا لرسولك (صلى الله عليه وآله وسلم) ضروباً من الشر والغدر، فعجزوا عنها، وحُلت بينهم وبينها، فكانت الوجبة بي والدائرة عليّ، اللهمّ احفظ حسناًوحسيناً، ولا تمكّن فجرة قريش منهما ما دمت حيّاً، فإذا توفّيتني فأنت الرقيب عليهم وأنت على كلّ شيء شهيد.
“Ya Allah, aku memohon dari Mu agar melawan Quraisy, karena mereka telah memendam bermacam sikpa jahat dan pengkhianatan kepada Rasul-Mu saw., lalu mereka lemah dari meluapkannya, dan Engkau menghalang-halangi mereka darinya, maka dicicipkannya kepadaku dan dialamatkannya ke atasku. Ya Allah peliharalah Hasan dan Husain, jangan Engkau beri kesempatan orang-orang durjana dari Quraisy itu membinasakan keduanya selagi aku masih hidup. Dan jika Engkau telah wafatkan aku, maka Engkau-lah yang mengontrol mereka, dan Engkau Maha Menyaksikan segala sesuatu.”[7]
Coba Anda perhatikan pernyataan Imam Ali as. di atas, bagaimana dendam dan pengkhianatan Quraisy terhadap Nabi saw. akan mereka luapkan kepadanya! Dan di dalamnya juga terdapat penegasan bahwa mereka tidak segan-segan akan menghabisi nyawa bocah-bocah mungil kesayangan Rasulullah saw.; Hasan dan Husain as. yang akan meneruskan garis keturunan kebanian sebagai melampiasan dendam mereka kepada Nabi saw.!
.
[1]Nahjul Balaghah, pidato ke3.
[2] Ibid. pidato ke74.
[3] Musnad Ahmad,6/339.
[4] Mustadrak al Hakim,3/140 dan 142.
[5] Al Mustadrak,3/139 hanya saja bagian akhir radaksi hadis ini terpotong, sepertinya ada “tangan-tangan terampil” yang sengaja menyensor hadis di atas.
[6]Teks hadis di atas sesuai dengan yang terdapat Majma’ az Zawâid,9/118.
[7] Syarah Nahjul Balaghhah, 20/298

………………………..

Rangkuman Riwayat Kebenaran 12 Imam Ahlilbait as

Kedudukan Hadis “Imam Ali Pemimpin Bagi Setiap Mukmin Sepeninggal Nabi SAW”

Diriwayatkan dengan berbagai jalan yang shahih dan hasan bahwa Rasulullah SAW bersabda kalau Imam Ali adalah Pemimpin bagi setiap mukmin sepeninggal Beliau SAW. Hadis tersebut diriwayatkan oleh Imran bin Hushain RA, Buraidah RA, Ibnu Abbas RA dan Wahab bin Hamzah RA. Rasulullah SAW bersabda

إن عليا مني وأنا منه وهو ولي كل مؤمن بعدي

Ali dari Ku dan Aku darinya dan Ia adalah Pemimpin bagi setiap mukmin sepeninggalKu.

.

Takhrij Hadis

Hadis di atas adalah lafaz riwayat Imran bin Hushain RA. Disebutkan dalam Musnad Abu Dawud Ath Thayalisi 1/111 no 829, Sunan Tirmidzi 5/296, Sunan An Nasa’i 5/132 no 8474, Mushannaf Ibnu Abi Syaibah 7/504, Musnad Abu Ya’la 1/293 no 355, Shahih Ibnu Hibban 15/373 no 6929, Mu’jam Al Kabir Ath Thabrani 18/128, dan As Sunnah Ibnu Abi Ashim no 1187. Semuanya dengan jalan sanad yang berujung pada Ja’far bin Sulaiman dari Yazid Ar Risyk dari Mutharrif bin Abdullah bin Syikhkhir Al Harasy dari Imran bin Hushain RA. Berikut sanad Abu Dawud

حدثنا جعفر بن سليمان الضبعي ، حدثنا يزيد الرشك ، عن مطرف بن عبد الله بن الشخير ، عن عمران بن حصين

Telah menceritakan kepada kami Ja’far bin Sulaiman Ad Dhuba’iy  yang berkata telah menceritakan kepada kami Yazid Ar Risyk dari Mutharrif bin Abdullah bin Syikhkhir dari Imran bin Hushain-alhadis- [Musnad Abu Dawud Ath Thayalisi no 829]

Hadis Imran bin Hushain ini sanadnya shahih karena para perawinya tsiqat

  • Ja’far bin Sulaiman Adh Dhuba’iy adalah seorang yang tsiqat. Ja’far adalah perawi Bukhari dalam Adabul Mufrad, Muslim dan Ashabus Sunan. Ibnu Ma’in, Ibnu Sa’ad, Ibnu Madini dan Ibnu Hibban menyatakan ia tsiqat. Ahmad bin Hanbal berkata “tidak ada masalah padanya”. Abu Ahmad mengatakan kalau Ja’far hadisnya baik, ia memiliki banyak riwayat dan hadisnya hasan [At Tahdzib juz 2 no 145]. Al Ajli menyatakan Ja’far bin Sulaiman tsiqat [Ma’rifat Ats Tsiqat no 221]. Ibnu Syahin juga memasukkannya sebagai perawi tsiqat [Tarikh Asma Ats Tsiqat no 166]. Kelemahan yang dinisbatkan kepada Ja’far adalah ia bertasayyyu’ tetapi telah ma’ruf diketahui bahwa tasyayyu’ Ja’far dikarenakan ia banyak meriwayatkan hadis-hadis keutamaan Ahlul Bait. Ibnu Hajar menyatakan ia shaduq tasyayyu’ [At Taqrib 1/162]. Adz Dzahabi menyatakan Ja’far bin Sulaiman tsiqat [Al Kasyf no 729]
  • Yazid Ar Risyk adalah Yazid bin Abi Yazid Adh Dhuba’iy seorang yang tsiqat perawi kutubus sittah. Tirmidzi, Abu Hatim, Abu Zar’ah, Ibnu Hibban dan Ibnu Sa’ad menyatakan ia tsiqah. Ahmad bin Hanbal menyatakan ia “shalih al hadis”.[At Tahdzib juz 11 no 616]. Disebutkan kalau Ibnu Ma’in mendhaifkannya tetapi hal ini keliru karena telah diriwayatkan dengan sanad yang shahih kalau Ibnu Ma’in justru menta’dilkannya. Ibnu Abi Hatim menukil Ad Dawri dari Ibnu Ma’in yang menyatakan Yazid “shalih” dan menukil Abu Bakar bin Abi Khaitsamah dari Ibnu Main yang menyatakan Yazid “laisa bihi ba’sun”. perkataan ini berarti perawi tersebut tsiqah menurut Ibnu Ma’in. [Al Jarh Wat Ta’dil 9/298 no 1268].
  • Mutharrif bin Abdullah adalah tabiin tsiqah perawi kutubus sittah. Ibnu Sa’ad menyatakan ia tsiqah. Al Ajli mengatakan ia tsiqah. Ibnu Hibban memasukkannya dalam Ats Tsiqah. [At Tahdzib juz 10 no 326]. Ibnu Hajar menyatakan Mutharrif bin Abdullah tsiqah [At Taqrib 2/188].

Hadis Imran bin Hushain di atas jelas sekali diriwayatkan oleh perawi tsiqah dan shahih sesuai dengan syarat Imam Muslim. Ja’far bin Sulaiman adalah perawi Muslim dan yang lainnya adalah perawi Bukhari dan Muslim. Ibnu Hajar menyatakan sanad hadis ini kuat dalam kitabnya Al Ishabah 4/569. Syaikh Al Albani menyatakan hadis ini shahih [Zhilal Al Jannah Takhrij As Sunnah no 1187]. Syaikh Syu’aib Al Arnauth menyatakan hadis ini sanadnya kuat [Shahih Ibnu Hibban no 6929]. Syaikh Husain Salim Asad menyatakan hadis ini para perawinya perawi shahih [Musnad Abu Ya’la no 355]

Selain riwayat Imran bin Hushain, hadis tersebut juga diriwayatkan oleh Buraidah RA. Hadis Buraidah disebutkan dalam Musnad Ahmad 5/356 no 22908[tahqiq Ahmad Syakir dan Hamzah Zain], Sunan Nasa’i 5/132 no 8475, Tarikh Ibnu Asakir 42/189 dengan jalan sanad yang berujung pada Ajlah Al Kindi dari Abdullah bin Buraidah dari ayahnya. Berikut sanad riwayat Ahmad

ثنا بن نمير حدثني أجلح الكندي عن عبد الله بن بريدة عن أبيه بريدة قال

Telah menceritakan kepada kami Ibnu Numair yang berkata telah menceritakan kepadaku Ajlah Al Kindi dari Abdullah bin Buraidah dari Ayahnya Buraidah yang berkata-hadis marfu’-[Musnad Ahmad 5/356 no 22908]

Hadis Buraidah ini sanadnya hasan karena diriwayatkan oleh perawi yang tsiqah yaitu Ibnu Numair dan Abdullah bin Buraidah dan perawi yang hasan yaitu Ajlah Al Kindi.

  • Ibnu Numair adalah Abdullah bin Numair Al Hamdani adalah perawi kutubus sittah yang dikenal tsiqah. Ibnu Ma’in, Ibnu Hibban, Al Ajli dan Ibnu Sa’ad menyatakan ia tsiqah. [At Tahdzib juz 6 no 110]. Ibnu Hajar menyatakan ia tsiqat [At Taqrib 1/542]. Adz Dzahabi menyatakan ia hujjah [Al Kasyf no 3024]
  • Ajlah Al Kindi adalah seorang yang shaduq. Ibnu Main dan Al Ajli menyatakan ia tsiqat. Amru bin Ali menyatakan ia seorang yang shaduq dan hadisnya lurus. Ibnu Ady berkata “ia memiliki hadis-hadis yang shalih, telah meriwayatkan darinya penduduk  kufah dan yang lainnya, tidak memiliki riwayat mungkar baik dari segi sanad maupun matan tetapi dia seorang syiah kufah, disisiku ia seorang yang shaduq dan hadisnya lurus”. Yaqub bin Sufyan menyatakan ia tsiqat tetapi ada kelemahan dalam hadisnya. Diantara yang melemahkannya adalah Ibnu Sa’ad, Abu Hatim, Abu Dawud dan An Nasa’i. [At Tahdzib juz 1 no 353]. Abu Hatim dan An Nasa’i menyatakan ia “tidak kuat” dimana perkataan ini bisa berarti seorang yang hadisnya hasan apalagi dikenal kalau Abu Hatim dan Nasa’i termasuk ulama yang ketat dalam menjarh. Ibnu Sa’ad dan Abu Dawud menyatakan ia dhaif tanpa menyebutkan alasannya sehingga jarhnya adalah jarh mubham. Tentu saja jarh mubham tidak berpengaruh pada mereka yang telah mendapat predikat tsiqat dari ulama yang mu’tabar. Ibnu Hajar menyatakan ia seorang syiah yang shaduq [At Taqrib 1/72]. Adz Dzahabi juga menyatakan Ajlah seorang yang shaduq [Man Tukullima Fiihi Wa Huwa Muwatstsaq no 13]. Bagi kami ia seorang yang tsiqah atau shaduq, Bukhari telah menyebutkan biografinya tanpa menyebutkan cacatnya [Tarikh Al Kabir juz 2 no 1711]. Hal ini menunjukkan kalau jarh terhadap Ajlah tidaklah benar dan hanya dikarenakan sikap tasyayyu’ yang ada padanya.
  • Abdullah bin Buraidah adalah seorang tabiin yang tsiqah. Ibnu Ma’in, Al Ajli dan Abu Hatim menyatakan ia tsiqat. Ibnu Kharasy menyatakan ia shaduq [At Tahdzib juz 5 no 270]. Ibnu Hajar menyatakan ia tsiqat [At Taqrib 1/480] dan Adz Dzahabi juga menyatakan ia tsiqat [Al Kasyf no 2644].

Sudah jelas hadis Buraidah ini adalah hadis hasan yang naik derajatnya menjadi shahih dengan penguat hadis-hadis yang lain. Syaikh Al Albani menyatakan bahwa hadis Buraidah ini sanadnya jayyid [Zhilal Al Jannah Takhrij As Sunnah no 1187].

Selain Imran bin Hushain dan Buraidah, hadis ini juga diriwayatkan oleh Ibnu Abbas dengan sanad yang shahih. Riwayat Ibnu Abbas disebutkan dalam Musnad Abu Dawud Ath Thayalisi 1/360 no 2752, Tarikh Ibnu Asakir 42/199, dan Tarikh Ibnu Asakir 42/201, Musnad Ahmad 1/330 no 3062, Al Mustadrak 3/143 no 4652, As Sunnah Ibnu Abi Ashim no 1188, dan Mu’jam Al Kabir 12/77. Berikut sanad riwayat Abu Dawud

حدثنا أبو عوانة عن أبي بلج عن عمرو بن ميمون عن بن عباس ان رسول الله صلى الله عليه و سلم

Telah menceritakan kepada kami Abu Awanah dari Abi Balj dari Amru bin Maimun dari Ibnu Abbas bahwa Rasulullah SAW bersabda [Musnad Abu Dawud Ath Thayalisi no 2752]

Hadis Ibnu Abbas ini sanadnya shahih dan diriwayatkan oleh para perawi yang tsiqat.

  • Abu Awanah adalah Wadhdhah bin Abdullah Al Yasykuri seorang perawi kutubus sittah yang tsiqat. Abu Hatim, Abu Zar’ah, Ahmad, Ibnu Sa’ad, Ibnu Abdil Barr menyatakan ia tsiqat. [At Tahdzib juz 11 no 204]. Al Ajli menyatakan ia tsiqah [Ma’rifat Ats Tsiqat no 1937].Ibnu Hajar menyatakan Abu Awanah tsiqat tsabit [At Taqrib 2/283] dan Adz Dzahabi juga menyatakan ia tsiqat [Al Kasyf no 6049].
  • Abu Balj adalah Yahya bin Sulaim seorang perawi Ashabus Sunan yang tsiqat. Ibnu Ma’in, Ibnu Sa’ad, Nasa’i dan Daruquthni menyatakan ia tsiqat. Abu Fath Al Azdi menyatakan ia tsiqat. Abu Hatim berkata “shalih laba’sa bihi”. Yaqub bin Sufyan berkata “tidak ada masalah padanya”. Al Bukhari berkata “fihi nazhar” atau perlu diteliti lagi hadisnya. [At Tahdzib juz 12 no 184]. Perkataan Bukhari ini tidaklah tsabit karena ia sendiri telah menuliskan biografi Abu Balj tanpa menyebutkan cacatnya bahkan dia menegaskan kalau Syu’bah meriwayatkan dari Abu Balj [Tarikh Al Kabir juz 8 no 2996]. Hal ini berarti Syu’bah menyatakan Abu Balj tsiqat karena ia tidak meriwayatkan kecuali dari perawi yang tsiqat. Ibnu Abdil Barr dan Ibnu Jauzi menyatakan bahwa Ibnu Main mendhaifkan Abu Balj [At Tahdzib juz 12 no 184]. Tentu saja perkataan ini tidak benar karena telah diriwayatkan dengan sanad yang shahih dari Ishaq bin Mansur kalau Ibnu Ma’in justru menyatakan Abu Balj tsiqat [Al Jarh Wat Ta’dil 9/153 no 634]. Kesimpulannya pendapat yang rajih adalah ia seorang yang tsiqat.
  • Amru bin Maimun adalah perawi kutubus sittah yang tsiqah. Al Ajli, Ibnu Ma’in, An Nasa’i dan Ibnu Hibban menyatakan ia tsiqat [At Tahdzib juz 8 no 181]. Ibnu Hajar menyatakan Amru bin Maimun tsiqat [At Taqrib 1/747].

Hadis Ibnu Abbas ini adalah hadis yang shahih dan merupakan sanad yang paling baik dalam perkara ini. Hadis ini juga menjadi bukti bahwa tasyayyu’ atau tidaknya seorang perawi tidak membuat suatu hadis lantas menjadi cacat karena sanad Ibnu Abbas ini termasuk sanad yang bebas dari perawi tasyayyu’. Hadis Ibnu Abbas ini telah dishahihkan oleh Al Hakim, Adz Dzahabi [Talkhis Al Mustadrak no 4652] dan Syaikh Ahmad Syakir [Musnad Ahmad no 3062].

Hadis dengan jalan yang terakhir adalah riwayat Wahab bin Hamzah. Diriwayatkan dalam Mu’jam Al Kabir Ath Thabrani 22/135, Tarikh Ibnu Asakir 42/199 dan Al Bidayah Wan Nihayah 7/381. Berikut jalan sanad yang disebutkan Ath Thabrani

حدثنا أحمد بن عمرو البزار وأحمد بن زهير التستري قالا ثنا محمد بن عثمان بن كرامة ثنا عبيد الله بن موسى ثنا يوسف بن صهيب عن دكين عن وهب بن حمزة قال

Telah menceritakan kepada kami Ahmad bin Amru Al Bazzar dan Ahmad bin Zuhair Al Tusturi yang keduanya berkata telah menceritakan kepada kami Muhammad bin Utsman bin Karamah yang berkata telah menceritakan kepada kami Ubaidillah bin Musa yang berkata telah menceritakan kepada kami Yusuf bin Shuhaib dari Dukain dari Wahab bin Hamzah yang berkata [Mu’jam Al Kabir 22/135]

Hadis ini diriwayatkan oleh para perawi tsiqat kecuali Dukain, ia seorang tabiin yang tidak mendapat predikat ta’dil dan tidak pula dicacatkan oleh para ulama.

  • Ahmad bin Amru Al Bazzar adalah penulis Musnad yang dikenal tsiqah, ia telah dinyatakan tsiqah oleh Al Khatib dan Daruquthni, Ibnu Qattan berkata “ia seorang yang hafizh dalam hadis [Lisan Al Mizan juz 1 no 750]
  • Ahmad bin Zuhair Al Tusturi adalah Ahmad bin Yahya bin Zuhair, Abu Ja’far Al Tusturi. Adz Dzahabi menyebutnya Al Imam Al Hujjah Al Muhaddis, Syaikh Islam. [As Siyar 14/362]. Dalam Kitab Tarajum Syuyukh Thabrani no 246 ia disebut sebagai seorang Hafizh yang tsiqat.
  • Muhammad bin Ustman bin Karamah seorang perawi yang tsiqat. Abu Hatim berkata “shaduq”. Maslamah dan Ibnu Hibban menyatakan ia tsiqat. Muhammad bin Abdullah bin Sulaiman dan Daud bin Yahya berkata “ia shaduq”. [At Tahdzib juz 9 no 563]. Ibnu Hajar menyatakan Muhammad bin Utsman bin Karamah tsiqat [At Taqrib 2/112]
  • Ubaidillah bin Musa adalah perawi kutubus sittah yang dikenal tsiqah. Ibnu Ma’in, Abu Hatim, Ibnu Hibban, Al Ajli, Ibnu Syahin, Utsman bin Abi Syaibah dan Ibnu Ady menyatakan ia tsiqah.[At Tahdzib juz 7 no 97]. Ibnu Hajar menyatakan Ubaidillah tsiqat tasyayyu’ [At Taqrib 1/640]. Adz Dzahabi juga menyatakan ia tsiqah [Al Kasyf no 3593].
  • Yusuf bin Shuhaib adalah seorang perawi tsiqat. Ibnu Ma’in, Abu Dawud, Ibnu Hibban, Utsman bin Abi Syaibah, Abu Nu’aim menyatakan ia tsiqat. Abu Hatim dan An Nasa’i berkata ‘tidak ada masalah padanya”. [At Tahdzib juz 11 no 710]. Ibnu Hajar menyatakan Yusuf bin Shubaih tsiqat [At Taqrib 2/344] dan Adz Dzahabi juga menyatakan Yusuf tsiqat [Al Kasyf no 6437]
  • Dukain adalah seorang tabiin. Hanya Ibnu Abi Hatim yang menyebutkan biografinya dalam Al Jarh Wat Ta’dil dan mengatakan kalau ia meriwayatkan hadis dari Wahab bin Hamzah dan telah meriwayatkan darinya Yusuf bin Shuhaib tanpa menyebutkan jarh maupun ta’dil terhadapnya. [Al Jarh Wat Ta’dil 3/439 no 1955]. Dukain seorang tabiin yang meriwayatkan hadis dari Wahab bin Hamzah dan sebagaimana disebutkan oleh Ibnu Sakan kalau Wahab bin Hamzah adalah seorang sahabat Nabi [Al Ishabah 6/623 no 9123]

Hadis Wahab bin Hamzah ini dapat dijadikan syawahid dan kedudukannya hasan dengan penguat dari hadis-hadis lain. Al Haitsami berkata mengenai hadis Wahab ini “Hadis riwayat Thabrani dan di dalamnya terdapat Dukain yang disebutkan oleh Ibnu Abi Hatim, tidak ada ulama yang mendhaifkannya dan sisanya adalah perawi yang dipercaya “ [Majma’ Az Zawaid 9/109].

.

.

Ibnu Taimiyyah Mendustakan Hadis Shahih

Jika kita mengumpulkan semua hadis tersebut maka didapatkan

  • Hadis Imran bin Hushain adalah hadis shahih [riwayat Ja’far bin Sulaiman]
  • Hadis Buraidah adalah hadis hasan [riwayatAjlah Al Kindi]
  • Hadis Ibnu Abbas adalah hadis shahih [riwayat Abu Balj]
  • Hadis Wahab bin Hamzah adalah hadis hasan [riwayat Dukain]

Tentu saja dengan mengumpulkan sanad-sanad hadis ini maka tidak diragukan lagi kalau hadis ini adalah hadis yang shahih. Dan dengan fakta ini ada baiknya kita melihat apa yang dikatakan Ibnu Taimiyyah tentang hadis ini, ia berkata

” أنت ولي كل مؤمن بعدي ” فهذا موضوع باتفاق أهل المعرفة بالحديث

“kamu adalah pemimpin bagi setiap mukmin sepeninggalKu” ini adalah maudhu’ (palsu) menurut kesepakatan ahli hadis [Minhaj As Sunnah 5/35]

قوله : هو ولي كل مؤمن بعدي كذب على رسول الله صلى الله عليه وسلم

Perkataannya ; “Ia pemimpin setiap mukmin sepeninggalku” adalah dusta atas Rasulullah SAW [Minhaj As Sunnah 7/278]

Cukuplah kiranya pembaca melihat dengan jelas siapa yang sebenarnya sedang berdusta atau sedang mendustakan hadis shahih hanya karena hadis tersebut dijadikan hujjah oleh orang syiah. Penyakit seperti ini yang dari dulu kami sebut sebagai “Syiahpobhia”.

.

.

Singkat Tentang Matan Hadis

Setelah membicarakan hadis ini ada baiknya kami membicarakan secara singkat mengenai matan hadis tersebut. Salafy nashibi biasanya akan berkelit dan berdalih kalau hadis tersebut tidak menggunakan lafaz khalifah tetapi lafaz waliy dan ini bermakna bukan sebagai pemimpin atau khalifah. Kami tidak perlu berkomentar banyak mengenai dalih ini, cukuplah kiranya kami bawakan dalil shahih kalau kata Waliy sering digunakan untuk menunjukkan kepemimpinan atau khalifah

Diriwayatkan oleh Ibnu Katsir [dan beliau menshahihkannya] dalam Al Bidayah wan Nihayah bahwa ketika Abu Bakar dipilih sebagai khalifah, ia berkhutbah

قال أما بعد أيها الناس فأني قد وليت عليكم ولست بخيركم

Ia berkata “Amma ba’du, wahai manusia sekalian sesungguhnya aku telah dipilih menjadi pimpinan atas kalian dan bukanlah aku yang terbaik diantara kalian. [Al Bidayah wan Nihayah 5/269]

Diriwayatkan pula oleh Ahmad bin Hanbal dalam Musnad Ahmad bin Hanbal bahwa Jabir bin Abdullah RA menyebutkan kepemimpinan Umar dengan kata Waliy

ثنا بهز قال وثنا عفان قالا ثنا همام ثنا قتادة عن عن أبي نضرة قال قلت لجابر بن عبد الله ان بن الزبير رضي الله عنه ينهى عن المتعة وان بن عباس يأمر بها قال فقال لي على يدي جرى الحديث تمتعنا مع رسول الله صلى الله عليه و سلم قال عفان ومع أبي بكر فلما ولي عمر رضي الله عنه خطب الناس فقال ان القرآن هو القرآن وان رسول الله صلى الله عليه و سلم هو الرسول وأنهما كانتا متعتان على عهد رسول الله صلى الله عليه و سلم إحداهما متعة الحج والأخرى متعة النساء

Telah menceritakan kepada kami Bahz dan telah menceritakan kepada kami Affan , keduanya [Bahz dan Affan] berkata telah menceritakan kepada kami Hamam yang berkata telah menceritakan kepada kami Qatadah dari Abi Nadhrah  yang berkata “aku berkata kepada Jabir bin Abdullah RA ‘sesungguhnya Ibnu Zubair telah melarang mut’ah dan Ibnu Abbas memerintahkannya’. Abu Nadhrah berkata ‘Jabir kemudian berkata kepadaku ‘kami pernah bermut’ah bersama Rasulullah’. [Affan berkata] “ dan bersama Abu Bakar. Ketika Umar menjadi pemimpin orang-orang, dia berkata ‘sesungguhnya Al Qur’an adalah Al Qur’an dan Rasulullah SAW adalah Rasul dan sesungguhnya ada dua mut’ah pada masa Rasulullah SAW, salah satunya adalah mut’ah haji dan yang satunya adalah mut’ah wanita’. [Musnad Ahmad 1/52 no 369 dishahihkan oleh Syaikh Syu’aib Al Arnauth dan Syaikh Ahmad Syakir]

Kedua riwayat di atas dengan jelas menunjukkan bahwa kata Waliy digunakan untuk menyatakan kepemimpinan para Khalifah seperti Abu Bakar dan Umar. Oleh karena itu tidak diragukan lagi bahwa hadis di atas bermakna Imam Ali adalah Pemimpin bagi setiap mukmin sepeninggal Nabi SAW.

1). Perumpamaan ahlilbaitku seperti perahu nuh, yang menaikinya selamat dan yang meninggalkannya tenggelam. (Al-Hakim, al-Mustadrak, ii, hlm. 343. Al-Dhahabi, al-Talkhis, ii, 345. al-Qunduzi al-Hanafi, Yanabi‘ al-Mawaddah , i, hlm. 27. al-Tabrani, al-Ausat, hlm. 216

.
2). Al-Bukhari, Sahih, viii, hlm. 384-385. ‘‘Sesungguhnya mereka (para sahabat) telah menjadi murtad selepasmu (irtaddu ba‘da-ka). Hanya sedikit daripada mereka yang terselamat seperti unta yang tersesat daripada pengembalanya”. Ia sejajar dengan firman-Nya Surah al-Saba’ (34):13 ‘‘Dan sedikit sekali daripada hamba-hamba-Ku yang bersyukur”
.
3). Sesungguhnya Allah Ta‘ala telah memandang ke Bumi, lalu Dia memilihku di kalangan mereka dan menjadikan aku seorang Nabi. Kemudian Dia memandang ke Bumi kali kedua, lalu Dia telah memilih suamimu dan Dia telah memerintahkanku supaya menikahkanmu dengannya. Dia telah memerintahkanku mengambilnya sebagai saudara, wazirwasi dan menjadikanya khalifahku pada umatku setelahku. Justeru itu, ayahmu ini adalah sebaik-baik Nabi Allah dan Rasul-Nya. Sementara suamimu adalah sebaik-baik wasi dan wazir. Al-Muttaqi al-Hindi, Kanz al-‘Ummal, vi, hlm. 153. al-Hakim, al-Mustadrak, iii, 159. al-Kanji al-Syafi‘i, Kifayah al-Talib, hlm. 491
.
4). Dan engkau adalah orang pertama yang akan mengikutiku (wafat) di kalangan keluargaku. Kemudian Dia telah merenung ke Bumi kali ketiga, lalu Dia memilihmu dan sebelas lelaki daripada anak cucumu dan suamimu. Lantaran itu, engkau adalah penghulu wanita Syurga. Sementara dua anak lelakimu adalah penghulu pemuda Syurga. Aku, saudaraku dan sebelas para imam dan para wasiku sehingga Hari Kiamat semuanya menjadi pembimbing dan mendapat petunjuk. Wasi pertama selepas saudaraku, adalah al-Hasan kemudian al-Husain, kemudian sembilan daripada anak anak al-Husain berada dalam satu martabat di Syurga.       Al-Qunduzi al-Hanafi, Yanabi‘ al-Mawaddah, hlm. 447
.
5). Al-Bukhari, Sahih, viii, hlm. 378-385, (Bab fi al-Haudh), hadis no. 578, 584, 585, 586, 587 dan 590, telah meriwayatkan bahawa para sahabat Nabi Saw. telah menjadi kafir-murtad selepas kewafatannya. Hadis no. 585. ‘‘Aku akan mendahului kalian di Haudh. Sesiapa yang melalui di hadapanku akan meminumnya dan siapa yang telah meminumnya tidak akan dahaga selama-lamanya. Kelak sebilangan orang yang aku kenali dan mereka pula mengenaliku akan dikemukakan di hadapanku. Kemudian mereka (para sahabatku) dipisahkan daripadaku. Ketika itu aku akan berkata: Mereka itu adalah daripadaku (para sahabatku)
.
Dijawab: Sesungguhnya mereka telah melakukan bid‘ah-bid‘ah (ahdathu ba‘da-ka) selepas anda meninggalkan mereka. Maka aku bersabda: Terjauh, terjauh (daripada rahmat) mereka yang telah mengubahkan (ghayyara) Sunnahku selepasku. Di dalam riwayat yang lain, Nabi saw bersabda: Wahai Tuhanku! Sesungguhnya mereka adalah para sahabatku (ashabi)! Dijawab: Sesungguhnya anda tidak mengetahui bid‘ah- bid‘ah (ahdathu) yang telah dilakukan oleh mereka selepas anda. Sesungguhnya mereka telah menjadi kafir-murtad kebelakang”. Hadis no.587“Hanya sedikit daripada mereka terselamat seperti unta yang terpisah daripada pengembalanya.” Lihat juga Muslim, Sahih, iv, hlm.1793-6 (Kitab al-Fadha’il), hadis no. 26, 28, 29, 31 dan 32. Hadis no. 26.‘‘Kerana kamu tidak mengetahui apa yang telah dilakukan oleh mereka selepas anda meninggalkan mereka. Maka aku bersabda: Terjauhlah, terjauhlah (daripada rahmat) mereka yang telah mengubah (baddala) sunnahku selepasku”
.
6). al-Turmudhi al-Hanafi, al-Kaukab al-Durriyy, hlm. 143, meriwayatkan sebuah hadis: ‘‘Ali adalah saudaraku, khalifahku dan pewaris ilmuku”.
6). Al-Qunduzi al-Hanafi, Yanabi‘ al-Mawaddah, hlm. 441, meriwayatkan bahawa Nabi Saw. telah menetapkan para imam dua belas. al-Bukhari, Sahih, iv, hlm. 120. Muslim, Sahih, ii, hlm. 81, meriwayatkan berkenaan dengan dua belas amir/khalifah/lelaki
.
7). Kemudian Umar memerintahkan orang ramai supaya membawa kayu api. Merekapun membawa kayu api, begitu juga dengan Umar. Kemudian kayu api itu diletakkan di sekeliling rumah Ali, Fatimah dan dua anak lelakinya. Kemudian Umar telah menyeru Ali. dan Fatimah. Demi Allah! kami akan mengeluarkan kalian wahai Ali! Oleh itu, hendaklah anda membai‘ah Khalifah Rasulullah
.
Jika tidak, aku akan menyalakan api ke atas anda. Maka Fatimah a.s. berkata: Wahai Umar! Apakah pertalian kami dengan anda? Umar berkata: Bukakan pintu, jika tidak kami akan membakar rumah kalian. Fatimah berkata: Wahai Umar! Tidakkah anda bertakwa kepada Allah, anda ingin memasuki rumahku? Namun Umar enggan pulang. Kemudian dia menyeru untuk mendapatkan api lantas menyalakannya di pintu lantas menolaknya dan terus memasuki rumah. Diapun berhadapan dengan Fatimah a.s Abu al-Fida’, Tarikh, i, hlm. 156. al-Tabari, Tarikh, iii, hlm.156-7.
Fatimah a.s. menjerit dan berkata: Wahai bapaku! Wahai Rasulullah!. Tetapi Umar telah mengangkat pedang yang masih tersarung dan meletakkannya di bahu Fatimah a.s. Fatimah melaung: Wahai bapaku! Maka Umarpun mengangkat cemetinya dan terus memukul bahu Fatimah. Fatimah a.s. menyeru lagi: Wahai Rasulullah! Sejahat-jahat manusia selepas anda wafat adalah Abu Bakr dan Umar
.
            Dalam pada itu, Ali a.s. telah melompat lalu memegang hidung dan tengkuk Umar. Hampir-hampir beliau membunuhnya, namun beliau mengingati kata-kata dan wasiat Rasulullah Saw. Beliaupun berkata: Demi orang yang memuliakan Muhammad dengan kenabian, wahai Ibn Sahhak (Umar)! Sekiranya tidak ada kitab daripada Allah terdahulu dan janji yang dijanjikan oleh Rasulullah Saw. kepadaku, nescaya anda mengetahui bahawa anda tidak akan memasuki rumahku
.
           Umar pun meminta orang ramai supaya memasuki rumah Ali manakala Ali a.s. pula telah menerkam ke arah pedangnya, lantas Qunfudh pulang menemui Abu Bakr kerana takut Ali a.s. akan keluar dengan pedangnya. Ibn Qutaibah, al-Imamah wa al-Siyasah, i, hlm. 14-15. al-Tabari, Tarikh, iii, hlm. 198.
8). Dia mengetahui akan kehebatan Ali a.s. Abu Bakr berkata kepada Qunfudh: Kembalilah kepada Ali dan jika dia tidak keluar, cerobohilah rumahnya. Jika dia enggan, nyalakan api ke atas mereka dan rumah mereka sekali
.
            Lalu Qunfudh al-Mal‘un datang semula. Dia dan para sahabatnya telah memasuki rumah Ali a.s. tanpa izin. Ali a.s. telah menerkam kepada pedangnya tetapi mereka mendahuluinya. Mereka datang berpusu-pusu kepadanya dalam jumlah yang ramai. Meskipun begitu Ali a.s. sempat merampas sebahagian daripada pedang mereka.            Akhirnya mereka mencampakkan tali ke leher Ali a.s. Fatimah a.s. pada masa itu yang berada di sebalik pintu dipukul oleh Qunfudh dengan cemeti lalu jatuh pengsan. Terdapat kesan di bahunya seperti warna hitam akibat daripada pukulan tersebut, la‘natullahi ‘alaihi. Kemudian Qunfudh melalui Ali a.s. yang sedang ‘digari’ dan membawanya ke hadapan Abu Bakr dan Umar yang sedang berdiri sambil memegang pedang di atas kepalanya
.
            Khalid bin al-Walid, Abu Ubaidah bin al-Jarrah, Salim maula Abi Hudhaifah, Mu‘adh bin Jabal, al-Mughirah bin Syu‘bah, Usyad bin Hudhair, Basyir bin S‘ad dan semua orang di sekitar Abu Bakr lengkap dengan senjata
.
            Akupun bertanya kepada Salman: Mereka telah memasuki rumah Fatimah tanpa izinnya? Salman menjawab: Ya. Demi Tuhan! Tidak ada di atasnya penutup (khimar), lalu Fatimah a.s. menyeru bapanya wahai bapaku! wahai Rasulullah! Sejahat-jahat manusia selepas anda meninggal adalah Abu Bakr dan Umar. Kedua-dua mata anda belum memejam dengan rapat dalam kuburan anda. Fatimah a.s. telah menyeru dengan suara yang tinggi. Akupun melihat Abu Bakr dan orang di sekelilingnya menangis melainkan Umar, Khalid dan al-Mughirah bin Syu‘bah. Umar berkata: Kami bukan perempuan kerana fikiran mereka tertumpu kepada perkara tertentu
.
            Salman berkata lagi: Mereka menyerahkan Ali a.s. kepada  Abu Bakr. Ali a.s. berkata: Demi Allah! jika terhunus pedang ditanganku maka kalian mengetahui bahawa kalian tidak akan sampai ke sini selama-lamanya. Demi Tuhan! aku tidak mencela diriku di dalam perjuangan kalian. Sekiranya aku dapat mengumpulkan empat puluh orang lelaki, nescaya aku dapat memecahkan kumpulan kalian. Tetapi Allah melaknati orang yang telah memberi bai‘ah kepadaku kemudian mereka tidak mematuhinya pula.
            Manakala Abu Bakr merenung kepadanya dia melaungkan suaranya: Berikan laluan untuknya. Ali a.s. membalas: Alangkah cepatnya kalian menghina Rasulullah Saw.! Di atas hak dan kedudukan manakah anda menyeru orang ramai supaya memberi bai‘ah kepada anda? Tidakkah anda telah memberi bai‘ah kepadaku kemarin dengan perintah Allah dan Rasul-Nya? Qunfudh la‘natullah, telah memukul Fatimah a.s. dengan cemeti apabila terpisah antaranya dan suaminya. Kemudian menolaknya sambil memukul bahunya. Maka gugurlah janinnya daripada perutnya. Fatimah a.s. sentiasa berada di atas hamparannya sehingga beliau mati syahid.
       Salman berkata: Manakala Ali a.s. dibawa kepada Abu Bakr, Umar memekik: Berilah bai‘ah dan tinggalkan kebatilan-kebatilan ini. Ali a.s berkata kepadanya: Sekiranya aku tidak melakukannya, apakah yang akan kalian lakukan kepadaku? Mereka berkata: Kami akan membunuh anda (naqtulu-ka) dengan penuh kehinaan. Beliau berkata: Jika begitu kalian membunuh seorang hamba Allah dan saudara Rasulullah? Abu Bakr menjawab: Adapun seorang hamba Allah, itu benar namun saudara Rasulullah, kami tidak mengakuinya. Ali berkata: Adakah kalian mengingkari bahawa Rasulullah Saw. telah mempersaudarakanku dengannya
Ibn Hanbal, Fadha’il al-Sahabah, ii, hlm. 617
.
9). Ali a.s. telah tampil di hadapan mereka seraya berkata: Wahai Muslimin, Muhajirin dan Ansar! Aku menyeru kalian dengan nama Allah, adakah kalian telah mendengar Rasulullah Saw. berkata pada Hari Ghadir Khum. Ibn Qutaibah, Kitab al-Ma‘arif, hlm. 251-2. Al-Suyuti, al-Durr al-Manthur, ii, hlm. 298
.
10). QS: AN_NISA, AYAT : 54. Maka sesungguhnya Kami telah mengurniakan keluarga Ibrahim akan al-Kitab dan al-Hikmah dan Kami kurniakan kepada mereka kerajaan yang besar”. Maka Al-Kitab adalah al-Nubuwwah(kenabian), al-Hikmah adalah al-Sunnah dan
Al-Mulk adalah al-khilafah. Dan kamilah keluarga Ibrahim. Al-Qunduzi al-Hanafi, Yanabi‘ al-Mawaddah, hlm. 120-1
.

Nabi Muhammad saww Adalah Penentu Para Imam Mazhab Syi’ah

Tapi cukuplah bagi kita sebagai bukti bahwa Ahlussunnah wal Jama’ah mengakui jumlah para Imam yang ke-12 itu, dan tidak terwujud para Imam itu selain ‘Ali dan anak-anaknya yang telah disucikan.
Seorang peneliti tidak akan dapat meragukan pelajaran sejarah Nabi saww dan pengetahuan sejarah Islam, bahwa Nabi saww telah menentukan para Imam yang ke dua belas (12 Imam as. ) dan beliau telah menetapkan mereka sebagai khalifah-khalifah setelahnya dan menjadi penerima wasiat di tengah umatnya. Telah disebutkan jumlah mereka dalam hadis-hadis shahih Ahlussunnah bahwa mereka itu adalah dua belas orang semuanya dari Quraisy, dan hal itu telah diriwayatkan oleh Bukhari dan Muslim serta lainnya. Sebagaimana dalam Sunni telah menyebutkan nama-nama mereka penjelasan Nabi Muhammad saww, bahwa yang pertama adalah ‘Ali bin Abi Thalib dan setelahnya ialah putranya yakni al-Hasan as,kemudian saudaranya al-Husein as, sedang yang terakhir ialah al-Mahdi. Sebagaimana tersebut dalam hadis berikut ini : Shahibu Yanabi’ al-Mawaddah telah meriwayatkan dalam kitabnya, dia berkata, “Seorang Yahudi disebut al-A’tal datang kepada Nabi Muhammad saww, dan ia berkata, “Hai Muhammad, saya menayakan kepadamu perkara-perkara yang telah terdetak dalam dadaku semenjak beberapa waktu, jika engkau dapat menjawabnya niscaya saya akan menyatakan masuk Islam di tanganmu.’Beliau menjawab, ‘Tanyalah! hai Aba Ammarah, maka ia menanyakan beberapa perkara yang sijawab oleh Nabi saww dan ia membenarkan, kemudian ia menanyakan, ‘Beritahukanlah padaku tentang penerimaan wasiatmu, siapakah ia itu? karena tidak seorang Nabi pun kecuali ia mempunyai seorang penerima wasiat, dan sesungguhnya Nabi kami Musa bin Imran telah berwasiat kepada Yusa’ bin Nun.’ Maka beliau bersabda, ‘Sesungguhnya penerima wasiatku adalah ‘Ali bin Abi Thalib dan setelahnya adalah kedua cucuku al-Hasan dan al-Husein kemudian beliau menyebutkan sembilan Imam dari tulang sulbi al-Husein. ‘Lalu ia berkata, ‘Ya Muhammad, sebutkanlah nama-nama mereka kepadaku!’ Beliau bersabda, “Bila al-Husein telah berlalu maka diganti oleh anaknya “Ali, bila ‘Ali telah berlalu maka diganti anaknya Muhammad, bila Muhammad berlalu maka diganti anaknya Ja’far, Musa, ‘Ali, Muhammad, ‘Ali, Hasan,al Hujjah Muhammad al-Mahdi as, maka itu semuanya adalah dua belas orang Imam.’ Kemudian orang Yahudi itu pun masuk Islam dan ia memuji Aallah SWT karena petunjuk-Nya.”(1)
.
Seandainya kita mau membuka lembaran kitab-kitab Syi’ah dan apa yang terkandung di dalamnya, dari hal kebenaran khusususnya tentang masalah ini niscaya kita akan mendapatkan lebih banyak dari itu. Tapi cukuplah bagi kita sebagai bukti bahwa Ahlussunnah wal Jama’ah mengakui jumlah para Imam yang ke-12 itu, dan tidak terwujud para Imam itu selain ‘Ali dan anak-anaknya yang telah disucikan. Dan yang dapat menambahkan kayakinan bagi kita ialah, bahwa Imam yang ke-12 dari Ahlulbait itu tidak pernah belajar pada satu orang pun dari para ulama umat ini, tidak ada yang meriwayatkan pada kita baik para ahli tarikh maupun ahli hadis dan sejarawan, bahwa salah seorang Imam dari Ahlulbait itu mendapatkan ilmunya dari sebagian sahabat atau tabi’in sebagaimana halnya para ulama umat dan para imam mereka.  Sebagaimana Abu Hanifah belajar kepada Imam Ja’far ash -Shadiq dan Malik belajar kepada Abu Hanifah sedang Syafi’i mendapat ilmu dari Malik dan ia mengambil darinya, begitu pula Ahmad bin Hanbal. Adapun para imam Ahlulbait maka ilmu mereka adalah merupakan pemberian dari Allah SWT yang mereka mewarisi dari Bapak yang berasal dari datuk mereka, mereka itulah yang diistimewakan oleh Allah SWT dengan firmannya:“Kemudian kami mewariskan kitab pada orang-orang yang telah kami pilih dari antara hamba-hamba Kami.”(QS.Fathir:32) Imam Ja’far ash-Shadiq pernah menyatakan tentang hakikat tersebut sekali waktu dengan ungkapannya, “Sungguh mengherankan orang-orang itu, mereka mengatakan bahwa mereka mengambil ilmu seluruhnya dari Rasulullah saww dan mengamalkannya serta mendapat petunjuk ! Kemudian mereka mengatakan bahwa kami Ahlulbait tidak mengambil ilmu beliau dan tidak mendapat petunjuk, padahal kami adalah keluarga dan keturunan beliau, di rumah kamilah wahyu itu diturunkan dan dari sisi kami ilmu itu keluar kepada manusia, apakah Anda menganggap mereka berilmu dan mendapat petunjuk sedangkan kami bodoh dan tersesat…?”
.
Ya, bagaimana Imam ash-Shadiq tidak mengherankan mereka itu yang mendakwahkan diri telah mengambil ilmu dari Rasulullah saww, padahal mereka memusuhi Ahlulbait beliau dan pintu ilmunya yang melalui dirinya ilmu itu diberikan, bagaimana tidak mengherankan penempatan nama Ahlussunnah, padahal mereka sendiri penentang sunah itu. Dan bila Syi’ah sebagaimana telah disaksikan oleh sejarah, mereka itu mengistimewakan ‘Ali dan membelanya serta mereka berdiri tegak menentang musuhnya, memerangi orang yang memeranginya, dan damai dengan orang yang damai dengannya dan mereka telah mengambil seluruh ilmu darinya. Maka Ahulussunnah wal Jama’ah itu tidaklah mengikuti dan ingin membinasakannya, dan mereka telah meneruskan sikap itu terhadap anak keturunan setelahnya dengan pembunuhan, penjara, dan pengusiran. Mereka telah bertentangan dengannya dalam kebanyakan hukum dengan dasar mengikuti para pendakwah ilmu pengetahuan yang mereka itu saling berselisih sesuai dengan pendapat dan ijtihad mereka dalam perkara hukum Allah, lalu mereka menggantikannya sesuai dengan hawa nafsu dan kepentingan yang mereka tuju. Dan bagaimana kita sekarang tidak heran terhadap orang-orang yang mendakwahkan mengikuti sunah Nabi saww, dan menyetakan sendiri telah meninggalkan sunah Nabi saww karena ia telah menjadi Syi’ah bagi Syi’ah, (2)
.
bukanlah ini merupakan hal yang mengherankan? Bagaimana kita tidak heran terhadap orang-orang yang mendakwahkan diri sebagai Ahlussunnah wal Jama’ah, sedang mereka merupakan kelompok yang banyak, seperti pengikut Maliki, Hanafi, Syafi’i dan Hambali yang mereka itu saling berselisih sebagian dengan lainnya dala hukum-hukum fiqih dan menganggap bahwa perselisihan itu adalah merupakan suatu rahmat bagi mereka, sehingga dengan demikian agama Allah SWT menjadi lampiasan hawa nafsu dan pendapat serta sasaran selera diri mereka. Memang benarlah, bahwa mereka adalah kelompok terbanyak yang saling berpecah-belah dalam hukum Allah SWT dan Rasul-Nya, tetapi mereka bersatu dan bersepakat dalam mengesakan kekhalifahan Saqifah yang durhaka dan bersepakat dalam meninggalkan dan menjauhkan keluarga Nabi saww, yang Suci.  Bagaimana kita tidak heran terhadap mereka itu yang membanggakan diri sebagai Ahlussunnah, padahal mereka telah meninggalkan yang berharga yakni Kitabullah dan keluarga Rasul betapapun mereka sendiri telah meriwayatkan hadis tersebut dan menshahihkannya…? Sesungguhnya mereka itu tidak berpegang baik pada Al-Qur’an maupun pada keluarga Rasul, sebab dengan meninggalkan keluarga Rasul yang suci itu berarti mereka telah meninggalkan Al-Qur’an, karena hadis yang mulia menetapkannya bahwa Al-Qur’an dan keluarga Rasul itu tidak pernah berpisah selama-lamanya, sebagaimana Rasulullah telah menyatakan hal itu dengan sabdanya: “Tuhan Yang Maha Halus lagi Maha Sadar telah memberitahukan padaku bahwa keduanya yakni Aal-Qur’an dan keluarga Rasul tidak akan pernah berpisah sehingga menemui aku di telaga surga.”(3)
.
Dan bagaimana kita tidak heran kepada kaum yang mendakwahkan diri sebagai Ahlussunnah padahal mereka bersikap menentang terhadap apa yang telah ditetapkan dalam kitab shahih mereka dari hal perbuatan Nabi saww dan perintahnya serta larangannya.(4)
.
Adapun bila kita meyakini dan membenarkan hadis, “aku tinggalkan pada kalian Kitabullah dan sunahku, selama kalian berpegang pada keduanya niscaya kalian tidak akan sesat selama-lamanya.” Sebagaimana yang telah ditetapkan bagi sebagian Ahlussunnah sekarang ini, maka keheranan itu akan menjadi lebih besar dan kecelakaan itu akan lebih jelas. Karena justru para tokoh mereka dan imam mereka itulah orang-orang yang telah membakar sunah yang telah ditinggalkan Rasulullah saww di kalangan mereka, dan telah mencegah periwayatannya dan penulisannya sebagaimana yang telah kita ketahui dalam pembahasan terdahulu. Umar bin khatab sendiri dengan terang-terangan telah menyatakan ucapan, “Cukup bagi kami Kitabullah,” itu adalah merupakan penolakan yang nyata terhadap Rasulullah saww, sedangkan orang yang menolak Rasulullah berarti menolak Allah SWT sebagaimana hal itu tak bisa disembunyikan lagi. Ucapan Umar bin Khathab tersebut telah diriwayatkan oleh seluruh hadis-hadis shahih Ahlussunnah termasuk di dalamnya Bukhari dan Muslim. Apabila Nabi saww telah bersabda, “Aku telah tinggalkan pada kalian Kitabullah dan sunahku, dan kami tidak membutuhkan sunahmu, dan bila Umar telah berkata dihadapan Nabi saww, “Cukup bagi kami Kitabullah, maka sesungguhnya Abu Bakar telah menguatkan untuk mewujudkan pandangan temannya itu lalu ia menyatakan setelah menjadi Khalifah: Janganlah kalian meriwayatkan suatu hadis dari Rasulullah saww, maka jika seseorang bertanya pada kalian, katakanlah di antara mereka kita dan kalian ada Kitabullah, maka halalkanlah apa yang telah dihalalkannya dan haramkanlah apa yang telah diharamkan. (5)
.
Bagaimana kita tidak heran terhadap kaum yang telah meninggalkan sunah Nabi saww mereka dan membelakanginya lalu mereka menggantikan kedudukannya dengan suatu bid’ah yang mereka perbuat yang mana tidak diizinkan oleh Allah SWT, kemudian mereka menamakan diri dan pengikutnya dengan Ahlussunnah wal Jama’ah…? Tetapi keheranan tersebut akan musnah ketika kita katahui bahwa Abu Bakar, Umar, dan Utsman sebenarnya tidak mengenal pemberian nama tersebut selama-lamanya. Inilah Abu Bakar yang telah menyatakan: Jika kalian membebani aku dengan sunah Nabi saww, niscaya aku tidak akan mampu. (6).
Bagaimana mungkin Abu Bakar tidak mampu menjalankan sunah Nabi saww? Apakah sunah beliau itu suatu perkara yang mustahil dilaksanakan, sehingga Abu bakar tidak mampu? Bagaimana Ahlussunnah bisa mendakwahkan diri berpegang padanya jika tokoh mereka yang pertama dan pembina mazhab mereka itu tidak mampu melaksanakan sunah? Bukankah Allah SWT menyatakan, “Pada diri Rasulullah suatu tauladan yang baik bagi kalian .” (QS. al-Ahzab:21)
.
dan firman-Nya, “Allah tidak membebani seseorang kecuali semampunya.” (QS. at-Thalaq:7) Dan juga firman-Nya, “Dan tidak menjadikan suatu kesulitan bagi kalian dalam agama.” (QS. al-Haj :78)
.
Apakah Abu Bakar dan temannya Umar menganggap bahwa Rasulullah telah menciptakan suatu agama yang bukan diturunkan oleh Allah SWT, lalu beliau memerintah kaum Muslim ini dengan sesuatu yang tak terangkat dan membebani mereka dengan kesuliatan? Hal itu tidak mungkin, bahkan yang sering beliau katakan yakni, “Gembirakanlah dan jangan jadikan mereka lari, mudahkanlah dan jangan kalian mempersulit, sesungguhnya Allah SWT telah memberi kalian keringanan maka jangan kalian memberatkan diri kalian sendiri.” Tetapi pengakuan Abu Bakar bahwa ia tidak mampu melaksanakan sunah Nabi saww itu adalah menguatkan apa yang menjadi pendapat kami bahwa ia telah melakukan suatu bid’ah yang mampu ia laksanakan sesuai dengan keinginannya dan sejalan dengan politik yang ia kuasai. Dan mungkin Umar bin Khathab berpandangan yang lain, bahwa hukum-hukum Al-Qur’an dan sunah itu tak mampu dilaksanakan, lalu ia sengaja meninggalkan shalat ketika ia junub sedangkan air tidak didapatinya dan ia berfatwa demikian di saat kekhalifahannya, sedang orang khusus dan yang umum telah mengetahui hal itu dan seluruh ahli hadis telah meriwayatkan itu darinya. Hal itu dikarenakan Umar adalah orang yang gemar banyak bersetubuh dan dialah yang disinggung oleh firman Allah SWT, “Allah mengetahui bahwa kalian mengkhianati diri kalian lalu Dia mengampuni kalian.” (Qs. al-Baqarah: 187)
.
Ini lantaran ia tidak mampu menahan diri dari bersetubuh di waktu puasa, dan dikarenakan air sangat sedikit maka Umar berpendapat bahwa yang paling mudah ialah meningalkan shalat dan bersantai-santai sampai ia mendapatkan air yang mencukupi untuk mandi, ketika itu baru ia kembali mengerjakan shalat. Adapun Utsman maka ia benar-benar telah mengabaikan sunah Nabi saww sebagaimana yang telah dikenal, sehingga ‘Aisyah mengeluarkan baju Nabi saww dan berkata, “Sungguh Utsman telah menghancurkan sunah Nabi saww sebelum baju beliau sendiri menjadi rusak.” Sehingga ia dicela oleh para sahabat bahwa ia telah menentang sunah Nabi saww, dan sunah Abu Bakar, Umar dan mereka pun membunuhnya lantaran itu. Mengenai Muawiyah, terserah apa yang Anda katakan, tidak mengapa, sesungguhnya ia telah meninggalkan Al-Qur’an dan sunah adalah dariku dan aku darinya, siapa yang mencaci ‘Ali sungguh telah mencaciku dan siapa yang mencaciku sungguh ia telah mencaci Allah SWT,” Kita dapati Muawiyah telah mengarahkan cacian dan kutukan padanya ia belum merasa cukup dengan itu sehingga ia memerintahkan seluruh wali-walinya dan para pegawainya untuk mencaci dan mengutuknya, siapa yang menolak di antara mereka maka ia disingkirkan dan dibunuh. Dan kita telah mengetahui bahwa Muawiyah itu adalah orang yang telah menamakan dirinya dan pengikutnya sebagai Ahlussunnah wal jama’ah dalam rangka menentang penamaan Syi’ah sebagai pengikut kebenaran. Dan sebagian ahli sejarah meriwayatkan bahwa tahun dimana Muawiyah memegang penuh kekuasaan umat Islam, setelah mengadakan perjanjian dengan al-Hasan bin ‘Ali Thalib bin Abi Thalib, maka tahun itu dinamakan tahun jama’ah. Dan keheranan pun akan hilang ketika kita memahami bahwa kata-kata sunah itu tidak dimaksudkan oleh Muawiyah dan pengikutnya kecuali hanyalah pengutukan ‘Ali bin Abi Thalib dari atas mimbar-mimbar Islam pada setiap hari Jumat dan hari Raya. Apabila Ahlussunnah wal Jama’ah itu merupakan rekayasa Muawiyah bin Abi Sofyan maka kita memohon pada Allah SWT agar mematikan kita di dalam bid’ah rafidhi yang telah dibina oleh ‘Ali bin Abi Thalib dan Ahlulbait (salam atas mereka). Anda tidak usah kaget wahai pembaca yang mulia, bila Ahlul bid’ah dan kesesatan itu menjadi Ahlussunnah wal Jama’ah sedang imam-imam yang suci dari Ahlulbait itu menjadi Ahli bid’ah. Inilah al-Allamah Ibnu Khaldun yang termasuk ulama termasyhur dari Ahlussunnah wal Jama’ah, ia menyatakannya dengan tegas setelah ia memerinci mazhab-mazhab jumhur ia mengatakan, “Ahlulbait itu menjadi terasing karena aliran faham yang mereka adakan dan fiqih yang berlainan dan mereka telah membina mazhab mereka atas dasar pencacian sebagian sahabat.” (7))
.
Wahai pembaca, bukankah saya telah katakan dari semula, seandainya Anda berbuat sebaliknya niscaya Anda benar/tepat. Maka jika orang-orang fasik dari kalangan Bani Umayah mereka itu adalah Ahlussunnah dan Ahlulbait itu adalah Ahli bid’ah seperti yang dikatakan Ibnu Khaldun, maka buat Islam ucapan selamat jalan dan buat dunia ucapan selamat datang
.
Foot note
  1. Riwayat al-Qunduzi al-Hanafi dalam kitab Yanabi’ al-Mawaddah, hal. 440, dan Faraid as-Samthain oleh al-Humawaini dengan sanad dari Ibnu Abbas.
  2. Sesuai pernyataan Ibnu Taimiyah untuk meninggalkan sunah Nabi saww bila itu  telah menjadi syi’ar bagi Syi’ah, lihat Minhaj as-Sunnah oleh Ibnu Taimiyah,II, hal.  143, dan Syarh al-Mawahib oleh Zargani,V, hal.13.
  3. Imam Ahmad dalam Musnad-nya, V, hal. 189, dan al-Hakim dalam Mustadark, III, hal. 148 dan ia menyatakan shahih menurut syarat Bukhari Muslim.
  4. Diriwayatkan Bukhari dalam Shahih-nya bahwa Nabi saww melarang shalat tarawih dalam bulan Ramadhan secara jama’ah dengan sabdanya, “Shalatlah wahai manusia di rumah-rumah kalian, sesungguhnya seutama-seutama shalat seseorang adalah di rumahnya selain shalat fardu.” Tetapi Ahlussunnah mengabaikan larangan Nabi saww dan mereka mengikuti bid’ah Umar bin Khathab.
  5. Tadzkirat al-Huffadz oleh Dzahabi, I, hal. 3.
  6. Lihat Musnad Ahmad bin Hanbal, I, hal. 4
  7. Muqaddaimah Ibnu Khaldun, hal. 494 dalam fasal Ilmu Fiqih
  8. .

.

Kembali Kepada Al Quran dan Ahlul Bait

Islam adalah keduanya (Al Quran dan Ahlul Bait) yang tidak akan terpisah hingga akhir zaman, hingga kehadiran Ahlul Bait Rasulullah yang terakhir, Imam Mahdi afs yang dinanti-natikan. Ahlul Bait adalah madrasah yang paling komplit yang mengandung berbagai khazanah ke- Islaman. Madrasah ini telah terbukti menghasilkan kader-kader yang mumpuni dan telah mempersembahkan karya-karya cemerlang bagi kehidupan umat manusia.
Sepanjang sejarah perjalanan umat manusia, polemik dan perbedaan pendapat telah menjadi keniscayaan tersendiri yang tak terelakkan. Adanya paradigma (cara pandang) yang berbeda pada umat manusia adalah konklusi dari dua jalan (kebajikan dan kejahatan) yang telah diilhamkan Allah SWT dalam diri setiap manusia (baca Qs. 90:10)
.
Oleh karenanya, keberadaan tolok ukur kebenaran yang menjadi rujukan semua pihak adalah suatu keniscayaan pula, yang eksistensinya bagian dari hikmah Ilahi. Allah SWT telah menurunkan kitab pedoman yang merupakan tolok ukur kebenaran dan menjadi penengah untuk menyelesaikan berbagai hal yang diperselisihkan umat manusia
.
Allah SWT berfirman: “Manusia itu (dahulunya) satu umat. Lalu Allah mengutus para Nabi (untuk) menyampaikan kabar gembira dan peringatan. Dan diturunkan-Nya bersama mereka kitab yang mengandung kebenaran, untuk memberi keputusan di antara manusia tentang perkara yang mereka perselisihkan.” (Qs. Al-Baqarah : 213)
.
Ayat ini menjelaskan bahwa manusia tanpa bimbingan dan petunjuk Ilahi akan berpecah belah dan bergolong-golongan. Penggalan selanjutnya pada ayat yang sama menjelaskan pula, bahwa kedengkian dan memperturutkan hawa nafsulah yang menyebabkan manusia terlibat dalam perselisihan dan perpecahan.
Kebijaksanaan Ilahilah yang kemudian menurunkan sang Penengah (para nabi as) yang membawa kitab-kitab yang menerangi. Kitab-kitab Ilahiah terutama Al Quran memberikan petunjuk dan arahan yang jelas tentang kebenaran yang seharusnya ditempuh umat manusia.
Namun hawa nafsu, kedengkian, kedurhakaan dan juga kebodohan telah menjerumuskan manusia jauh berpaling dari mata air jernih kebenaran.
Puluhan ribu nabi telah diutus sepanjang sejarah hidup manusia di segala penjuru dunia. Umat Islam meyakini mata rantai kenabian bermula dari Nabi Adam as dan berakhir di tangan Muhammad SAW dan tidak ada lagi nabi sesudahnya
.
Ditutupnya kenabian hanya bisa sesuai dengan hikmah dan falsafah diutusnya para nabi bila syariat samawi yang terakhir tersebut memenuhi seluruh kebutuhan umat manusia, di setiap masa dan di setiap tempat. Al Quran sebagai kitab samawi terakhir telah dijamin oleh Allah SWT keabadian dan keutuhannya dari berbagai penyimpangan hingga akhir masa.
Akan tetapi secara zahir Al Quran tidak menjelaskan hukum-hukum dan ajaran Islam secara mendetail. Oleh karenanya penjelasan perincian hukum menjadi tanggung jawab nabi untuk menerangkannya kepada seluruh umatnya.Sewaktu Nabi Muhammad SAW masih hidup tanggung jawab itu berada dipundaknya. Karena itu hadits-hadits Nabi Muhammad SAW menjadi hujah dan sumber autentik ajaran Islam. Namun apakah semasa hidupnya, Rasulullah SAW telah menjelaskan seluruh hukum dan syariat Islam kepada seluruh umat?
.
Kalau tidak semua, siapa yang bertanggung jawab untuk menjelaskannya? Siapa pula yang bertanggung jawab menengahi silang sengketa sekiranya terjadi penafsiran yang berbeda tentang ayat-ayat Al Quran dalam tubuh umat Islam?
Saya sulit menerima jika dikatakan tanggung jawab penjelasan syariat Islam pasca Rasul jatuh ke tangan para sahabat. Sementara untuk contoh sederhana sahabat sendiri berbeda pendapat bagaimana cara Rasululullah melakukan wudhu dan salat yang benar, padahal Rasul mempraktikkan wudhu dan salat bertahun-tahun di hadapan mereka
.
Untuk persoalan wudhu saja mereka menukilkan pendapat yang berbeda-beda, karenanya pada masalah yang lebih rumit sangat mungkin terjadi penukilan yang keliru. Ataupun tanggung jawab penafsiran Al Quran jatuh kepada keempat imam mazhab yang untuk sekadar menafsirkan apa yang dimaksud debu pada surah Al-Maidah ayat 6 saja sulit menemukan kesepakatan
.
Kata mazhab Syafi’i debu meliputi pasir dan tanah, tanah saja kata Hanbali; tanah, pasir, batuan, salju dan logam kata Maliki; tanah, pasir dan batuan kata Hanafi (al-Mughniyah, 1960; Al-Jaziri, 1986)
.
Petunjuk Umat
Islam hanya dapat ditawarkan sebagai agama yang sempurna, yang dapat memenuhi segala kebutuhan manusia jika di dalam agama itu sendiri tidak terdapat perselisihan dan perpecahan. Karenanya, hikmah Ilahi meniscayakan adanya orang-orang yang memiliki kriteria seperti yang dimiliki Nabi Muhammad SAW untuk memberikan bimbingan kepada umat manusia di setiap masa tentunya selain syariat
.
Ilmu yang mereka miliki tidak terbatas dengan apa yang pernah disampaikan Nabi Muhammad SAW (sebagaimana maklum Nabi tidak sempat menjelaskan semua tentang syariat Islam) namun juga memiliki potensi mendapatkan ilmu langsung dari Allah SWT ataupun melalui perantara sebagaimana ilham yang diterima Siti Maryam dan ibu nabi Musa as (Lihat Qs. Ali-Imran : 42, Thaha:38)
.
Mereka menguasai ilmu Al Quran sebagaimana penguasaan nabi Muhammad SAW sehingga ucapan-ucapan merekapun merupakan hujjah dan sumber autentik ajaran Islam. Masalah ini berkaitan dengan Al Quran sebagai mukjizat, berkaitan dengan kedalaman dan ketinggian Al Quran, sehingga hukumnya membutuhkan penafsir dan pengulas
.
Al Quran adalah petunjuk untuk seluruh ummat manusia sampai akhir zaman karenanya akan selalu berlaku dan akan selalu ada yang akan menjelaskannya sesuai dengan pengetahuan Ilahi. “Sungguh, Kami telah mendatangkan kitab (Al Quran) kepada mereka, yang Kami jelaskan atas dasar pengetahuan, sebagai petunjuk dan rahmat bagi orang-orang yang beriman.” (Qs. Al-A’raf :52)
.
Pada ayat lain, Allah SWT berfirman, “Dan Kami tidak menurunkan kepadamu al-Kitab ini, melainkan agar kamu dapat menjelaskan kepada mereka apa yang mereka perselisihkan itu dan menjadi petunjuk dan rahmat bagi kaum yang beriman. ” (Qs. An-Nahl : 64).
Dengan pemahaman seperti ini maka jelaslah maksud dari penggalan hadits Rasulullah, Kutinggalkan bagi kalian dua hal yang berharga, Al Quran dan Ahlul Baitku. (HR Muslim). Bahwa keduanya Al Quran dan Ahlul Bait adalah dua hal yang tak terpisahkan hingga hari kiamat, memisahkan satu sama lain akibatnya adalah kesesatan dan di luar dari koridor ajaran Islam itu sendiri
.
Penyimpangan
Rasul menyebut keduanya (Al Quran dan Ahlul Baitnya) sebagai Tsaqalain yakni sesuatu yang sangat berharga. Keduanya saling melengkapi dan tidak dapat dipisahkan. Penerus nabi adalah orang-orang yang tahu interpretasi ayat-ayat Al Quran sesuai dengan makna sejatinya, sesuai dengan karakter esensial Islam, sebagaimana yang dikehendaki Allah SWT
.
Rasulullah menjamin bahwa siapapun yang bersungguh-sungguh dan berpegang pada kedua tsaqal ini, maka tidak akan pernah mengalami kesesatan. Kemunduran dan penyimpangan kaum Muslimin terjadi ketika mencoba memisahkan kedua tsaqal ini
.
Islam adalah keduanya (Al Quran dan Ahlul Bait) yang tidak akan terpisah hingga akhir zaman, hingga kehadiran Ahlul Bait Rasulullah yang terakhir, Imam Mahdi afs yang dinanti-natikan. Ahlul Bait adalah madrasah yang paling komplit yang mengandung berbagai khazanah ke- Islaman. Madrasah ini telah terbukti menghasilkan kader-kader yang mumpuni dan telah mempersembahkan karya-karya cemerlang bagi kehidupan umat manusia.
Imam Ja’far Shadiq (fiqh), Jalaluddin Rumi (tasawuf), Ibnu Sina (kedokteran), Mullah Sadra (Filsafat), Allamah Taba’tabai (tafsir) dan Imam Khomeini (politik), sebagian kecil orang-orang besar yang terlahir dari madrasah ini.

Mayoritas UMAT KHiANATi Ali PASCA NABi SAW WAFAT

MAYORiTAS  SAHABAT  KHiANATi  Ali  PASCA  NABi  SAW WAFAT

Qs. Al An’am ayat 65-67

Qs. 6:65. Katakanlah (Muhammad), “Dialah yang berkuasa mengirimkan azab kepadamu, dari atas atau dari bawah kakimu atau Dia mencampurkan kamu dalam golongan golongan (yang saling bertentangan) dan merasakan kepada sebagian kamu keganasan sebagian yang lain.” Perhatikanlah bagaimana Kami menjelaskan berulang ulang tanda tanda (kekuasaan Kami) agar mereka memahami (nya)

Qs. 6:66. Dan kaummu mendustakannya (azab) padahal (azab) itu benar adanya. Katakanlah (Muhammad), “Aku ini bukanlah penanggung jawab kamu”

Qs. 6:67. Setiap berita (yang dibawa oleh Rasul) ada (waktu) terjadinya dan kelak kamu akan mengetahui

Dikutip dari  “AL HiDAYAH ALQURAN TAFSiR PERKATA TAJWID KODE ANGKA PENERBIT KALiM”  yang disahkan DEPAG, halaman 136 :

Asbabun Nuzul Qs.6 : 65-67 : Zaid bin Aslam mengatakan bahwa Rasulullah SAW bersabda  kepada para sahabat, “Setelah kepergianku, janganlah kalian kembali menjadi kafir dengan saling membunuh diantara kalian”. Mereka berkata, “Kami bersaksi bahwa tidak ada Tuhan selain Allah dan sesungguhnya engkau adalah Rasul Nya. “Sebagian yang lain berkata, “ini tidak akan pernah terjadi untuk selamanya, yaitu saling membunuh diantara kita, sementara kita semua adalah muslim.” Maka turunlah ketiga ayat ini (HR. Ibnu Abi Hatim)

Wahai para pembaca…

Qs. Asy Syu’ara; ayat 205-207

Qs.26 : 205  : Maka bagaimana pendapatmu jika kepada mereka kami berikan kenikmatan hidup beberapa tahun,

Qs.26 : 206  : Kemudian datang kepada mereka azab yang diancamkan kepada mereka,

Qs.26 : 207  : Niscaya tidak berguna bagi mereka kenikmatan yang mereka rasakan

Dikutip dari  “AL HiDAYAH ALQURAN TAFSiR PERKATA TAJWID KODE ANGKA PENERBIT KALiM”  yang disahkan DEPAG, halaman  376 :

Asbabun Nuzul Qs.26 : 205-207 : Menurut Abu Jahdham, ketiga ayat ini diturunkan berkenaan dengan Rasulullah yang suatu ketika terlihat bingung dan gelisah. Para sahabat menanyakan hal itu. “Aku bermimpi, setelah aku wafat kelak, aku melihat musuhku yang ternyata adalah berasal dari umatku sendiri,” jawab Rasulullah (HR.ibnu Abi Hatim)

Hadis dari sahabat  Jarir bin ‘Abdillah Al Bajali dari Nabi SAW : “janganlah kalian kembali kafir sepeninggalku, sebagian kalian menebas leher yang lain” (HR. Bukhari no. 7080 dan HR. Muslim no.65)

Hadis Nabi SAW : “Mencaci seorang muslim adalah suatu kefasikan dan membunuhnya adalah suatu kekufuran” (Hr.Bukhari Muslim)

Kedudukan Hadis Umat Mengkhianati Ali Sepeninggal Nabi SAW

Rasulullah SAW telah mengabarkan kepada Imam Ali bahwa sepeninggal Beliau SAW, umat akan mengkhianati Imam Ali. Hal ini telah dinyatakan dalam hadis-hadis shahih. Salah satunya dalam hadis berikut

حدثنا أبو حفص عمر بن أحمد الجمحي بمكة ثنا علي بن عبد العزيز ثنا عمرو بن عون ثنا هشيم عن إسماعيل بن سالم عن أبي إدريس الأودي عن علي رضى الله تعالى عنه قال إن مما عهد إلي النبي صلى الله عليه وسلم أن الأمة ستغدر بي بعده

Telah menceritakan kepada kami Abu Hafsh Umar bin Ahmad Al Jumahi di Makkah yang berkata telah menceritakan kepada kami Ali bin Abdul Aziz yang berkata telah menceritakan kepada kami Amru bin ‘Aun yang berkata telah menceritakan kepada kami Husyaim dari Ismail bin Salim dari Abi Idris Al Awdi dari Ali Radhiyallahu ‘anhu yang berkata “Diantara yang dijanjikan Nabi SAW kepadaku bahwa Umat akan mengkhianatiku sepeninggal Beliau”. [Hadis riwayat Al Hakim dalam Al Mustadrak 3/150 no 4676 dishahihkan oleh Al Hakim dan Adz Dzahabi dalam At Talkhis]

Hadis ini adalah hadis yang shahih sebagaimana yang dikatakan oleh Al Hakim dan Adz Dzahabi. Selain itu hadis ini juga diriwayatkan oleh Ad Dulabi dalam Al Kuna Wal Asmaa’ 2/442 no 441

حدثنا يحيى بن غيلان ، عن أبي عوانة ، عن إسماعيل بن سالم ، وحدثنا فهد بن عوف ، قال ، ثنا أبو عوانة ، عن إسماعيل بن سالم ، عن أبي إدريس إبراهيم بن أبي حديد الأودي أن علي بن أبي طالب ، قال : عهد إلي النبي صلى الله عليه وسلم أن الأمة ستغدر بي من بعده

Telah menceritakan kepada kami Yahya bin Ghailan dari Abu ‘Awanah dari Ismail bin Salim dan telah menceritakan kepada kami Fahd bin Auf yang berkata telah menceritakan kepada kami Abu ‘Awanah dari Ismail bin Salim dari Abi Idris Ibrahim bin Abi Hadid Al Awdi bahwa Ali bin Abi Thalib berkata “telah dijanjikan oleh Nabi SAW bahwa Umat akan mengkhianatiku sepeninggal Beliau”.

Hadis ini sanadnya shahih dan diriwayatkan oleh para perawi yang terpercaya yaitu sanad Yahya bin Ghailan dari Abu Awanah dari Ismail bin Salim dari Ibrahim bin Abi Hadid dari Ali. Ibrahim adalah seorang tabiin yang melihat atau bertemu dengan Ali.

  • Yahya bin Ghailan dia adalah perawi Muslim Nasa’i dan Tirmidzi. Ibnu Hajar menyebutkan biografinya dalam At Tahdzib juz 11 no 429 dan ia telah dinyatakan tsiqat oleh Ibnu Sahl, Al Khatib, Ibnu Hibban, dan Ibnu Sa’ad. Ibnu Hajar dalam At Taqrib 2/312 menyatakan ia tsiqat.
  • Abu ‘Awanah dia adalah Wadhdhah bin Abdullah Al Yasykuri perawi Bukhari Muslim dan Ashabus Sunan. Ibnu Hajar menyebutkan biografinya dalam At Tahdzib juz 11 no 204 dan ia telah dinyatakan tsiqat oleh Abu Hatim, Abu Zar’ah, Ahmad, Ibnu Hibban, Ibnu Sa’ad dan Ibnu Abdil Bar. Dalam At Taqrib 2/283 ia dinyatakan tsiqat . Adz Dzahabi dalam Al Kasyf no 6049 juga mengatakan ia tsiqah.
  • Ismail bin Salim adalah perawi Bukhari dalam Adabul Mufrad, Muslim, Abu Dawud dan An Nasa’i. Ibnu Hajar dalam At Tahdzib juz 1 no 554 menyebutkan bahwa ia dinyatakan tsiqat oleh Ibnu Sa’ad, Ahmad, Abu Hatim, Abu Zar’ah, Daruquthni, Yaqub Al Fasawi, Abu Ali Al Hafiz dan Ibnu Hibban. Dalam At Taqrib 1/94 ia dinyatakan tsiqat.
  • Ibrahim bin Abi Hadid dia adalah seorang tabiin yang tsiqah. Ibnu Hibban memasukkannya dalam Ats Tsiqat juz 4 no 1613. Al Bukhari dalam Tarikh Al Kabir juz 1 no 908 menyebutkan keterangan tentangnya bahwa telah meriwayatkan darinya Ismail bin Salim tanpa menyebutkan jarh terhadapnya. Sehingga Ibrahim bin Abi Hadid adalah tabiin yang tsiqah dan Al Bukhari juga menyebutkan kalau ia bertemu atau melihat Ali bin Abi Thalib RA.

Jadi hadis riwayat Ad Dulabi dalam Al Kuna adalah hadis yang shahih. Sebelum mengakhiri tulisan ini kami akan membantah syubhat kalau Ibrahim bin Abi Hadid itu majhul dan hadisnya dari Ali mursal.

.

Syubhat Abu Hatim

Abu Hatim dalam Al Jarh Wat Ta’dil 2/96 menyebutkan kalau riwayat Ibrahim bin Abi Hadid dari Ali mursal dan ia seorang yang majhul. Pernyataan ini tertolak dengan dasar ulama-ulama lain mengenalnya seperti Ibnu Hibban, Al Bukhari dan Ibnu Ma’in. Dalam Tarikh Ibnu Ma’in no 1861 riwayat ad Dawri berkata

سمعت يحيى يقول أبو إدريس إبراهيم بن أبى حديد قلت ليحيى هو الذي يروى عنه إسماعيل بن سالم قال نعم

Aku mendengar Yahya mengatakan Abu Idris Ibrahim bin Abi Hadid. Aku bertanya kepada Yahya “diakah yang telah meriwayatkan darinya Ismail bin Salim”. Ia menjawab “ benar”.

Kemudian juga disebutkan dalam Tarikh Ibnu Ma’in no 2547 dari Ad Dawri

سمعت يحيى يقول أبو إدريس إبراهيم بن أبي حديد صاحب إسماعيل بن سالم

Aku mendengar Yahya mengatakan Abu Idris Ibrahim bin Abi Hadid sahabat Ismail bin Salim.

Pernyataan Abu Hatim bahwa riwayat Ibrahim bin Abi Hadid dari Ali mursal adalah pernyataan keliru dan itu didasari oleh ketidaktahuannya akan siapa Ibrahim bin Abi Hadid. Al Bukhari berkata dalam Tarikh Al Kabir juz 1 no 908

قال لي بن زرارة أخبرنا هشيم قال حدثنا إسماعيل بن سالم عن أبي إدريس نظرت إلى علي

Telah berkata kepadaku Ibnu Zurarah yang mengabarkan kepada kami Husyaim yang menceritakan kepada kami Ismail bin Salim bahwa Abu Idris melihat Ali.

Atsar ini shahih. Ibnu Zurarah adalah Syaikh(guru) Bukhari dan telah dinyatakan dalam At Taqrib 1/735 bahwa ia tsiqat dan Husyaim bin Basyir disebutkan dalam At Taqrib 2/269 kalau ia tsiqat tsabit. Sedangkan Ismail bin Salim telah disebutkan ketsiqahannya. Riwayat Bukhari ini sebaik-baik bukti yang membantah pernyataan Abu Hatim.

Selain diriwayatkan oleh Ibrahim bin Abi Hadid, hadis tersebut juga diriwayatkan oleh Tsa’labah bin Yazid Al Himmani. Hadis Tsa’labah diriwayatkan dalam Tarikh Dimasyq Ibnu Asakir 42/447, Musnad Al Bazzar 3/91, Dalail Nubuwwah Baihaqi 7/312 no 2759 dan Al Kamil Ibnu Ady 6/216. Berikut sanad hadis Tsa’labah bin Yazid yang terdapat dalam kitab Al Mathalib Al Aliyah Ibnu Hajar 11/205 no 4018

حدثنا الفضل هو أبو نعيم ثنا فطر بن خليفة أخبرني حبيب بن أبي ثابت قال سمعت ثعلبة بن يزيد قال سمعت عليا يقول والله إنه لعهد النبي الأمي صلى الله عليه وسلم

Telah menceritakan kepada kami Fadhl (dia Abu Nu’aim) yang berkata telah menceritakan kepada kami Fithr bin Khalifah yang berkata telah mengabarkan kepadaku Habib bin Abi Tsabit yang berkata aku mendengar Tsa’labah bin Yazid berkata aku mendengar Ali mengatakan Demi Allah, sesungguhnya Nabi yang ummi telah menjanjikan kepadaku.

Sanad ini adalah sanad yang shahih dan tidak diragukan keshahihannya, kecuali oleh mereka yang tidak senang dengan matan hadis tersebut.

  • Fadhl bin Dukain atau Abu Nu’aim adalah perawi Bukhari Muslim dan Ashabus Sunan yang dikenal tsiqah. Ibnu Hajar dalam At Tahdzib juz 8 no 505 menyebutkan bahwa ia dinyatakan tsiqat oleh Ahmad, Yaqub bin Syaibah, Ibnu Sa’ad, Ibnu Syahin Abu Hatim dan yang lainnya. Dalam At Taqrib 2/11 Ibnu Hajar menyatakan ia tsiqat.
  • Fithr bin Khalifah adalah perawi Bukhari dan Ashabus Sunan. Ibnu Hajar dalam At Tahdzib juz 8 no 550 menyebutkan bahwa ia dinyatakan tsiqat oleh Ahmad bin Hanbal, Yahya bin Sa’id, Ibnu Ma’in, Ibnu Sa’ad, Al Ajli, Nasa’i, dan Ibnu Hibban. Dalam At Taqrib 2/16 Ibnu Hajar menyatakan ia shaduq (jujur).
  • Habib bin Abi Tsabit adalah perawi Bukhari Muslim dan Ashabus Sunan. Ibnu Hajar dalam At Tahdzib juz 2 no 323 menyebutkan kalau ia dinyatakan tsiqat oleh Al Ajli, An Nasa’i, Abu Hatim, Ibnu Ma’in, Ibnu Hibban,  dan Ibnu Ady. Dalam At Taqrib 1/183 ia dinyatakan tsiqat.
  • Tsa’labah bin Yazid adalah seorang tabiin yang tsiqat. Ibnu Hajar dalam At Tahdzib juz 2 no 42 menyebutkan bahwa ia dinyatakan tsiqat oleh An Nasa’i dan Ibnu Hibban memasukkannya dalam Ats Tsiqat. Al Bukhari berkata bahwa hadis-hadisnya perlu diteliti lagi dan tidak diikuti. Pernyataan Bukhari tidaklah benar, hadis Tsa’labah bin Yazid ini ternyata diikuti oleh yang lainnya yaitu oleh Ibrahim bin Abi Hadid dan Hayyan Al Asdi, mereka semua meriwayatkan dari Ali RA.  Ibnu Ady mengakui kalau Tsa’labah tidak memiliki hadis-hadis mungkar. Ibnu Hajar dalam At Taqrib 1/149 menyatakan ia seorang syiah yang shaduq.

Sekali lagi kami katakan hadis ini shahih dan tidak ada gunanya syubhat yang dilontarkan oleh sebagian orang. Diantara mereka, ada yang berhujjah dengan pernyataan Al Bukhari dalam Tarikh Al Kabir juz 2 no 2103 biografi Tsa’labah bin Yazid dimana Bukhari berkata “perlu diteliti lagi” kemudian Al Bukhari membawakan hadis Tsa’labah ini dan berkata “tidak diikuti”. Kami sudah katakan bahwa Al Bukhari tidaklah benar, hadis ini diikuti oleh yang lain yaitu Ibrahim bin Abi Hadid dan Hayyan Al Asdi.

Ibnu Hibban ternyata memuat biografi Tsa’labah bin Yazid dalam Al Majruhin no 170 dan mengatakan bahwa ia berlebihan dalam tasyayyu’ tidak bisa dijadikan hujjah jika menyendiri meriwayatkan dari Ali. Kami katakan pencacatan karena tasyayyu’ tidaklah diterima dan Ibnu Hibban sendiri memasukkan Tsa’labah bin Yazid sebagai perawi tsiqah dalam Ats Tsiqat juz 4 no 1995 ditambah lagi Tsa’labah tidak menyendiri meriwayatkan hadis ini.

Semua syubhat tersebut sangat lemah dan telah dijelaskan kekeliruannya tetapi mereka salafiyun tetap tidak rela kalau hadis ini dikatakan shahih. Padahal jika diteliti dengan standar ilmu hadis yang benar maka tidak diragukan lagi bahwa hadis ini bersanad shahih. Wallahu’alam

 

Setelah kaum muslimin menyalati jenazah Nabi saw., Imam Ali as. menggali kuburan untuknya. Setelah itu, ia menguburkan jenazah sau-daranya itu.Kekuatan Ali telah melemah. Ia berdiri di pinggiran kubur sembari menutupi kuburan itu dengan tanah dengan disertai linangan air mata. Ia mengeluh: “Sesungguhnya sabar itu indah, kecuali terhadapmu. Sesung-guhnya berkeluh-kesah itu buruk, kecuali atas dirimu. Sesungguhnya musibah atasmu sangat besar. Dan sesungguhnya sebelum dan sesudah-mu terdapat peristiwa besar.”[1]

Pada hari bersejarah itu, bendera keadilan telah terlipat di alam kesedihan, tonggak-tonggak kebenaran telah roboh, dan cahaya yang telah menyinari alam telah lenyap. Beliaulah yang telah berhasil meng-ubah perjalanan hidup umat manusia dari kezaliman yang gelap gulita kepada kehidupan sejahtera yang penuh dengan peradAbân dan keadilan. Dalam kehidupan ini, suara para tiran musnah dan jeritan orang-orang jelata mendapat perhatian. Seluruh karunia Allah terhampar luas untuk hamba-hamba-Nya dan tak seorang pun memiliki kesempatan untuk menimbun harta untuk kepentingannya sendiri.

Muktamar Tsaqîfah

Dalam sejarah dunia Islam, muslimin tidak pernah menghadapi tragedi yang sangat berat sebagai cobaan dalam kehidupan mereka seberat peris-tiwa Tsaqîfah yang telah menyulut api fitnah di antara mereka sekaligus membuka pintu kehancuran bagi kehidupan mereka.

Kaum Anshar telah melangsungkan muktamar di Tsaqîfah Bani Sâ‘idah pada hari Nabi saw. wafat. Muktamar itu dihadiri oleh dua kubu, suku Aus dan Khazraj. Mereka berusaha mengatur siasat supaya kekha-lifahan tidak keluar dari kalangan mereka. Mereka tidak ingin muktamar tersebut diikuti oleh kaum Muhajirin yang secara terus terang telah menolak untuk membaiat Imam Ali as. yang telah dikukuhkan oleh Nabi saw. sebagai khalifah dan pemimpin umat pada peristiwa Ghadir Khum. Mereka tidak ingin bila kenabian dan kekhalifahan berkumpul di satu rumah, sebagaimana sebagian pembesar mereka juga pernah menentang Nabi saw. untuk menulis wasiat berkenaan dengan hak Ali as. Ketika itu mereka melontarkan tuduhan bahwa Nabi saw. sedang mengigau sehing-ga mereka pun berhasil melakukan makar tersebut.

Ala kulli hal, kaum Anshar telah berperan sebagai tulang punggung bagi kekuatan bersenjata pasukan Nabi saw. dan mereka pernah mene-barkan kesedihan dan duka di rumah-rumah kaum Quraisy yang kala itu hendak melakukan perlawanan terhadap Rasulullah saw. Ketika itu orang-orang Quraisy betul-betul merasa dengki terhadap kaum Anshar. Oleh karena itu, kaum Anshar segera mengadakan muktamar, karena khawatir terhadap kaum Muhajirin.

Hubâb bin Munzdir berkata: “Kami betul-betul merasa khawatir bila kalian diperintah oleh orang-orang yang anak-anak, nenek moyang, dan saudara-saudara mereka telah kita bunuh.”[2]

Kekhawatiran Hubbâb itu ternyata menjadi kenyataan. Setelah usia pemerintahan para khalifah usai, dinasti Bani kaum Umayyah berkuasa. Mereka berusaha merendahkan dan menghinakan para khalifah itu. Mu‘âwiyah telah berbuat zalim dan kejam. Ketika Yazîd bin Mu‘âwiyah memerintah, dia juga bertindak sewenang-wenang dan menghancurkan kehormatan mereka dengan berbagai macam siksa dan kejahatan. Yazîd menghalalkan harta, darah, dan kehormatan mereka pada tragedi Harrah. Sejarah tidak pernah menyaksikan kekejian dan kekezaman semacam itu.

Ala kulli hal, pada muktamar Tsaqîfah tersebut, kaum Anshar men-calonkan Sa‘d sebagai khalifah, kecuali Khudhair bin Usaid, pemimpin suku Aus. Ia enggan berbaiat kepada Sa‘d karena kedengkian yang telah tertanam antara sukunya dan suku Sa‘d, Khazraj. Sudah sejak lama memang hubungan antara kedua suku ini tegang.

‘Uwaim bin Sâ‘idah bangkit bersama Ma‘n bin ‘Adî, sekutu Anshar, untuk menjumpai Abu Bakar dan Umar. Mereka ingin memberitahukan kepada dua sahabat ini peristiwa yang sedang berlangsung di Tsaqîfah. Abu Bakar dan Umar terkejut. Mereka segera pergi menuju ke Tsaqîfah secara tiba-tiba. Musnahlah seluruh cita-cita yang telah dirajut oleh kaum Anshar. Wajah Sa‘d berubah. Setelah terjadi pertikaian yang tajam antara Abu Bakar dan kaum Anshar, kelompok Abu Bakar segera bangkit untuk membaiatnya. Umar yang bertindak sebagai pahlawan dalam baiat itu telah memainkan peranannya yang aktif di ajang perebutan kekuasaan itu. Dia menggiring masyarakat untuk membaiat sahabatnya, Abu Bakar. Abu Bakar keluar dari Tsaqîfah diikuti oleh para pendukungnya menuju ke masjid Nabi saw. dengan diiringi oleh teriakan suara takbir dan tahlil. Dalam baiat ini, pendapat keluarga Nabi saw. tidak dihiraukan. Begitu pula pendapat para pemuka sahabatnya, seperti Ammâr bin Yâsir, Abu Dzar, Miqdâd, dan sahabat-sahabat yang lain.

Sikap Imam Ali as. Terhadap Pembaiatan Abu Bakar

Para sejarawan dan perawi hadis sepakat bahwa Imam Ali as. menolak dan tidak menerima pembaiatan atas Abu Bakar. Ia lebih berhak untuk menjadi khalifah. Karena beliaulah orang yang paling dekat dengan Nabi saw. Kedudukan Ali as. di sisi Nabi saw. seperti kedudukan Hârûn di sisi Mûsâ as. Islam telah tegak karena perjuangan dan keberaniannya. Dia mengalami berbagai macam bencana dalam menegakkan Islam. Nabi saw. menjadikan Ali as. sebagai saudaranya. Ia pernah bersabda kepada kaum muslimin: “Barang siapa yang aku adalah pemimpinnya, maka Ali adalah juga pemimpinnya.”

Atas dasar ini, Ali as. menolak untuk membaiat Abu Bakar. Abu Bakar dan Umar telah bersepakat untuk menyeret Ali as. dan memak-sanya berbaiat. Umar bin Khaththab bersama sekelompok pengikutnya mengepung rumah Ali as. Dia menakut-nakuti, mengancam, dan meng-gertak Ali as. dengan menggenggam api untuk membakar rumah wahyu itu. Buah hati Nabi saw. dan penghulu para wanita semesta alam keluar dan bertanya dengan suara lantang: “Hai anak Khaththab, apa yang kamu bawa itu?” Umar menjawab dengan keras: “Yang aku bawa ini lebih hebat daripada yang telah dibawa oleh ayahmu.”[3]

Sangat disayangkan dan menggoncang kalbu setiap orang muslim! Mereka telah berani bertindak keras seperti itu terhadap Fatimah Az-Zahrâ’ as., buah hati Nabi saw. Padahal Allah ridha karena keridhaan Az-Zahrâ’ dan murka karena kemurkaannya. Melihat kelancangan ini, tidak ada yang layak kita ucapkan selain innâ lillâh wa innâ ilaihi râji‘ûn.

Akhirnya, mereka memaksa Imam Ali as. keluar dari rumahnya dengan paksa. Dengan pedang terhunus para pendukung Khalifah Abu Bakar menyeret Imam Ali as. untuk menghadap. Mereka berkata dengan lantang: “Baiatlah Abu Bakar! Baiatlah Abu Bakar!”

Imam Ali as. membela diri dengan hujah yang kokoh tanpa rasa takut sedikit pun terhadap kekerasan dan kekuatan mereka. Ia berkata: “Aku lebih berhak atas perkara ini daripada kalian. Aku tidak akan membaiat kalian, sebaliknya kalianlah yang semestinya membaiatku. Kalian telah merampas hak ini dari kaum Anshar dengan alasan bahwa kalian memiliki hubungan kekerabatan dengan Nabi saw. Tetapi kalian juga telah merampas kekhalifahan itu dari kami Ahlul Bait secara paksa. Bukankah kalian telah mendakwa di hadapan kaum Anshar bahwa kalian lebih berhak atas kekhilafahan ini daripada mereka dengan dalih Nabi Muhammad saw. berasal dari kalangan kalian, sehingga mereka rela memberikan dan menyerahkan kepemimpinan itu kepadamu? Kini aku juga ingin berdalih kepadamu seperti kamu berdalih kepada kaum Anshar. Sesungguhnya aku adalah orang yang lebih utama dan lebih dekat dengan Nabi saw., baik ketika ia masih hidup maupun setelah wafat. Camkanlah ucapanku ini, jika kamu beriman! Jika tidak, maka kamu telah berbuat zalim sedang kamu menyadarinya.”

Betapa indah hujah dan dalil tersebut. Kaum Muhajirin dapat mengalahkan kaum Anshar lantaran hujah itu, karena mereka merasa memiliki hubungan kekerabatan yang sangat dekat dengan Nabi saw. Argumentasi Imam Ali as. lebih kuat, lantaran suku Quraisy yang terdiri dari banyak kabilah dan memiliki hubungan kekeluargaan dengan Nabi saw. itu bukan sepupu-sepupu atau pamannya. Sementara hubungan kekerabatan antara Nabi saw. dengan Imam Ali as. terjalin dalam bentuk yang paling sempurna. Ali as. adalah sepupu Nabi saw., ayah dua orang cucunya, dan suami untuk putri semata wayangnya.

Walau demikian, Umar tetap memaksa Imam Ali as. dan berkata: “Berbaiatlah!”

“Jika aku tidak melakukannya?”, tanya Imam Ali pendek.

“Demi Allah yang tiada tuhan selain Dia, jika engkau tidak mem-baiat, aku akan penggal lehermu”, jawab Umar sengit.

Imam Ali as. diam sejenak. Ia memandang ke arah kaum yang telah disesatkan oleh hawa nafsu dan dibutakan oleh cinta kekuasaan itu. Imam Ali as. melihat tidak ada orang yang akan menolong dan membe-lanya dari kejahatan mereka. Akhirnya ia menjawab dengan nada sedih: “Jika demikian, kamu telah membunuh hamba Allah dan saudara Rasu-lullah.”

Umar segera menimpali dengan berang: “Membunuh hamba Allah, ya. Tetapi saudara Rasulullah, tidak.”

Umar telah lupa dengan sabda Nabi saw. bahwa Imam Ali as. adalah saudaranya, pintu kota ilmunya, dan kedudukannya di sisinya adalah sama dengan kedudukan Hârûn di sisi Mûsâ as. Ali as. adalah pejuang pertama Islam. Semua realita dan keutamaan itu telah dilupakan dan diingkari oleh Umar.

Kemudian Umar menoleh ke arah Abu Bakar seraya menyuruhnya untuk mengingkari hal itu. Kepada Abu Bakar, Umar berkata: “Mengapa engkau tidak menggunakan kekuasaanmu untuk memaksanya?”

Abu Bakar takut fitnah dan hal-hal yang tidak diinginkan terjadi. Akhirnya dia menentukan sikap: “Aku tidak akan memaksanya, selama Fatimah berada di sisinya.”

Akhirnya mereka membebaskan Imam Ali as. Ia berlari menuju ke makam saudaranya, Nabi saw., untuk mengadukan cobaan dan aral yang sedang menimpanya. Ia menangis tersedu-sedu seraya berkata: “Wahai putra ibuku, sesungguhnya kaum ini telah meremehkanku dan hampir saja mereka membunuhku.”[4]

Mereka telah meremehkan Imam Ali as. dan mengingkari wasiat-wasiat Nabi saw. berkenaan dengan dirinya. Setelah itu ia kembali ke rumah dengan hati yang hancur luluh dan sedih. Benar, telah terjadi apa yang telah diberitakan oleh Allah swt. akan terjadi pada umat Islam setelah Rasulullah saw. wafat. Mereka kembali kepada kekufuran. Allah swt. berfirman:

Muhammad itu tidak lain hanyalah seorang rasul; sungguh telah berlalu sebelumnya beberapa orang rasul. Apakah jika ia wafat atau dibunuh, kamu berbalik ke belakang (murtad)? Barang siapa yang berbalik ke belakang, maka ia tidak dapat mendatangkan mudarat kepada Allah sedikit pun ….”(QS. Âli ‘Imrân [3]:144)

Sungguh mereka telah kembali kepada kekufuran, kekufuran yang dapat menghancurkan iman dan harapan-harapan mereka. Innâ lillâh wa innâ ilaihi râji‘ûn.

Kita tutup lembaran peristiwa-peristiwa yang mengenaskan dan segala kebijakan pemerintah Abu Bakar yang tiran terhadap keluarga Nabi saw. ini, seperti merampas tanah Fadak, menghapus khumus, dan kebijakan-kebijakan yang lain. Seluruh peristiwa ini telah kami jelaskan secara rinci dalam Mawsû‘ah Al-Imam Amiril Mukminin as.

Fatimah Az-Zahrâ’ Menuju ke Alam Baka

Salah satu peristiwa yang sangat menyedihkan Imam Ali as. adalah kepergian buah hati Rasulullah saw., Fatimah Az-Zahrâ’ as. Ia jatuh sakit, sementara hatinya yang lembut tengah merasakan kesedihan yang mendalam. Rasa sakit telah menyerangnya. Dan kematian begitu cepat menghampirinya, sementara usianya masih begitu muda. Oh, betapa beratnya duka yang menimpa buah hati dan putri semata wayang Nabisaw. itu. Ia telah mengalami berbagai kekejaman dan kezaliman dalam masa yang sangat singkat setelah ayahandanya wafat. Mereka telah mengingkari kedudukannya yang mulia di sisi Rasulullah, merampas hak warisannya dan menyerang rumahnya.

Fatimah Az-Zahrâ’ telah menyampaikan wasiat terakhir yang maha penting kepada putra pamannya. Dalam wasiat itu ditegaskan agar orang-orang yang telah ikut serta merampas haknya tidak boleh menghadiri pemakaman, jenazahnya dikuburkan pada malam hari yang gelap gulita, dan kuburannya disembunyikan agar menjadi bukti betapa ia murka kepada mereka.

Imam Ali as. melaksanakan wasiat istrinya yang setia itu di pusara-nya yang terakhir. Ia berdiri di pinggir makamnya sambil menyiramnya dengan tetesan-tetesan air mata. Ia menyampaikan ucapan takziah, bela sungkawa dan pengaduan kepada Nabi saw. setelah menyampaikan salam kepada beliau:

Salam sejahtera untukmu dariku, ya Rasulullah, dan dari putrimu yang telah tiba di haribaanmu dan yang begitu cepatnya menyusulmu. Ya Rasulullah, betapa sedikitnya kesabaranku dengan kemangkatanmu dan betapa beratnya hati ini. Hanya saja, dalam perpisahan denganmu dan besarnya musibahmu ada tempat untuk berduka. Aku telah membaring-kanmu di liang kuburmu. Dan jiwamu telah pergi meninggalkanku ketika kepalamu berada di antara leher dan dadaku. Innâ lillâh wa innâ ilaihi râji‘ûn. Titipan telah dikembalikan dan gadai pun telah diambil kembali. Tetapi kesedihanku tetap abadi. Malam-malamkupun menjadi panjang, hingga Allah memilihkan untukku tempatmu yang kini engkau singgahi. Putrimu akan bercerita kepadamu tentang persekong-kolan umatmu untuk berbuat kejahatan. Tanyakanlah dan mintalah berita mengenai keadan mereka! Padahal perjanjian itu masih hangat dan namamu masih disebut-sebut. Salam sejahtera atasmu berdua, salam selamat tinggal, tanpa lalai dan jenuh! Jika aku berpaling, itu bukan karena bosan. Jika aku diam, itu bukan karena aku berburuk sangka terhadap apa yang dijanjikan Allah kepada orang-orang yang sabar.[5]

Ungkapan-ungkapan Imam Ali as. di atas menunjukkan betapa ia menga-lami kesedihan yang mendalam atas kepergian titipan Rasulullah saw. itu. Ungkapan-ungkapan itu juga menunjukkan betapa dalamnya sakit hati dan duka yang dialaminya akibat perlakuan umat Islam. Imam Ali as. juga minta kepada Nabi saw. agar memaksa putrinya bercerita dan memberi-kan keterangan tentang seluruh kejahatan dan kezaliman yang telah dilakukan oleh umatnya itu.

Seusai menguburkan jenazah buah hati Nabi saw., Imam Ali as. kembali ke rumah dengan rasa duka dan kesedihan yang datang silih berganti. Para sahabat telah mengasingkannya. Imam Ali as. berpaling sebagaimana mereka juga berpaling darinya. Ia bertekad untuk menjauhi seluruh urusan politik dan tidak terlibat di dalamnya.


1.Nahjul Balaghah, khotbah ke-409.

2.Hayâh Al-Imam Husain as., Jil. 1/ 235.

3.Ansâb Al-Asyrâf, karya Al-Balâdzurî. Para sejarahwan sepakat tentang adanya ancaman Umar terhadap Ali as. untuk membakar rumahnya itu. Silakan merujuk Târîkh Ath-Thabarî, Jil. 3/202, Târikh Abi Al-Fidâ’, Jil. 1/156, Târîkh Al-Ya‘qûbî, Jil. 2/105, Murûj Adz-Dzahab, Jil. 1/414, Al-Imâmah wa As-Siyâsah, Jil. 1/12, Syarah Nahjul Balâghah, karya Ibn Abil Hadîd, Jil. 1/ 34, Al-Amwâl, karya Abu ‘Ubaidah, hal. 131, A‘lâm An-Nisâ’, Jil. 3/205, danAl-Imam Ali, karya Abul Fattâh Maqshûd, Jil. 1/213.

4.Al-Imâmah wa As-Siyâsah, hal. 28-31.

5.Nahjul Balâghah, Jil. 2/ 182.

SERANGAN KE RUMAH FATHIMAH ; Hadist dari kalangan Ahlusunnah / Sunni

artikel2 seperti ini akan menyadarkan kebenaran yang semestinya diketahui orang2 yang berhikmat terhadap agamanya.

Literatur Ahlusunnah terkait Dengan Penyerangan ke Rumah Fatimah As

Terkait dengan hal ini kami akan mengutip beberapa matan dari kitab-kitab Ahlusunnah sehingga menjadi jelas bahwa masalah penyerangan kediaman Hadhrat  Fatimah Zahra Sa merupakan sebuah peristiwa sejarah faktual dan niscaya serta bukan sebuah mitos dan legenda!!

.

Meski pada masa para khalifah terjadi sensor besar-besaran terhadap penulisan keutamaan dan derajat (para maksum); akan tetapi kaidah menyatakan bahwa “hakikat (kebenaran) adalah penjaga sesuatu.” Hakikat sejarah ini tetap hidup dan terjaga dalam kitab-kitab sejarah dan hadis. Di sini kami akan mengutip beberapa referensi dengan memperhatikan urutan masa semenjak abad-abad pertama hingga masa kiwari.

1. Ibnu Abi Syaibah dan kitab “Al-Mushannaf:  Abu Bakar bin Abi Syaibah (159-235 H) pengarang kitab al-Mushannaf dengan sanad sahih menukil demikian:  “Tatkala orang-orang memberikan baiat kepada Abu Bakar, Ali dan Zubair berada di rumah Fatimah berbincang-bincang dan melakukan musyawarah. Hal ini terdengar oleh Umar bin Khattab. Ia pergi ke rumah Fatimah dan berkata, “Wahai putri Rasulullah, ayahmu merupakan orang yang paling terkasih bagi kami dan setelah Rasulullah adalah engkau. Namun demi Allah! Kecintaan ini tidak akan menjadi penghalang.  Apabila orang-orang berkumpul di rumahmu maka Aku akan perintahkan supaya rumahmu dibakar. Umar bin Khattab menyampaikan ucapan ini dan keluar. Tatkala Ali As dan Zubair kembali ke rumah, putri Rasulullah Saw menyampaikan hal ini kepada Ali As dan Zubair: Umar datang kepadaku dan bersumpah apabila kalian kembali berkumpul maka ia akan membakar rumah ini. Demi Allah! Apa yang ia sumpahkan akan dilakukannya!

2. Baladzuri dan kitab “Ansab al-Asyrâf: Ahmad bin Yahya Jabir Baghdadi Baladzuri (wafat 270) penulis masyhur dan sejarawan terkemuka, mengutip peristiwa sejarah ini dalam kitab “Ansab al-Asyrâf” sebagaimaan yang telah disebutkan.  Abu Bakar mencari Ali As untuk mengambil baiat darinya, namun Ali tidak memberikan baiat kepadanya. Kemudian Umar bergerak disertai dengan alat untuk membakar dan kemudian bertemu dengan Fatima di depan rumah. Fatimah berkata, “Wahai putra Khattab! Saya melihat kau ingin membakar rumahku? Umar berkata, “Iya. Perbuatan ini akan membantu pekerjaan yang untuknya ayahmu diutus.”

SERANGAN KE RUMAH FATHIMAH..

Kekhalifahan Abu Bakar merupakan ijma ulama yang wajib diterima bagi setiap Muslim. Pertama-tama perlu dijelaskan bahwa kita percaya ijma bersifat mengikat. oleh sebab itu Ahlu Sunnah wal Jam’ah menentukan WAJIB mengikuti ijma’ apapun konsekuensinya hingga penentangan Thd kekhalifahan hasil ijma’ HARUS diterima bahkan jika diperlukan bisa dipaksakan diterima .

Tidak semua sahabat sepakat bahwa keempat khalifah ini adalah pengganti Nabi Muhammad yang sah. Kaum Muslimin sepakat bahwa kekhalifahan Abu Bakar dipilih oleh sejumlah orang yang terbatas dan merupakan hal yang mengejutkan bagi sahabat lainnya. Oleh sejumlah orang terbatas artinya mayoritas sahabat Nabi Muhammad yang utama tidak mengetahui pemilihan ini. Ali, Ibnu Abbas, Utsman, Thalhah, Zubair, Sa’d bin Abi Waqqash, Salman Farisi, Abu Dzar, Ammar bin Yasir, Miqdad, Abdurrahman bin Auf adalah di antara sahabat-sahabat yang tidak diajak berunding bahkan diberitahu. Bahkan Umar sendiri mengakui, pemilihan Abu Bakar dilakukan tanpa perundingan dengan kaum Muslimin.( l )

Kita tidak dapat menutup mata pada kenyataan yang tidak dapat disangkal yang bahkan dicatat oleh ulama-ulama Sunni dan meskipun telah menjadi ijma. Setelah Nabi Muhammad wafat, orang-orang yang melaksanakan apa yang diperintahkan Nabi Muhammad seperti Ammar bin Yasir, Abu Dzar Ghiffari, Miqdad, Salman Farisi, Ibnu Abbas, dan sahabat-sahabat lain seperti Abbas, Utbah bin Abi Lahab, Bara bin Azib, Ubay bin Ka’b, Sa’d bin Abi Waqqash, dan lain-lain berkumpul di rumah Fathimah.

Demikian juga dengan Thalhah dan Zubair yang awalnya setia kepada Ali dan bergabung dengan yang lainnya di rumah Fathimah. Mereka berkumpul di rumah Fathimah sebagai tempat berlindung karena mereka menentang mayoritas orang-orang. Berdasarkan hadis Shahih Bukhari, Umar mengakui bahwa Ali dan pengikutnya menentang Abu Bakar.

Bukhari meriwayatkan bahwa Umar berkata,

“Tidak diragukan lagi setelah Rasul wafat, kami diberi tahu bahwa kaum Anshar tidak sepakat dengan kami dan berkumpul di balairung Bani Saidah. Ali dan Zubair dan orang – orang yang bersama mereka menentang kami.”(2)

Hadis lain meriwayatkan bahwa Umar berkata pada hari Saqifah,

“Ali bin Abi Thalib, Zubair bin Awwam dan orang-orang yang bersama mereka berpisah dari kami dan berkumpul di rumah Fathimah, putri Nabi Muhammad.”(3)

Selain itu, mereka meminta persetujuan baiat tersebut, tetapi Ali dan Zubair meninggalkannya. Zubair menghunuskan pedang dan berkata, “Aku tidak akan menyarungkan pedang ini sebelum sumpah setia diberikan kepada Ali.” Ketika kabar ini sampai kepada Abu Bakar dan Umar, Umar berkata, “Lempar ia dengan batu dan rampas pedangnya!” Diriwayatkan bahwa Umar bergegas (menuju ke depan pintu Fathimah) dan menggiring mereka dengan paksa sambil mengatakan bahwa mereka harus memberikan sumpah setia secara sukarela ataupun paksa.(4)

Pemilihan seperti apakah itu? Pemilihan menyiratkan suatu pilihan dan kebebasan, dan setiap kaum Muslimin berhak memilih wakilnya. Barang-siapa yang memilihnya tidak menentang Allah atau Rasulnya karena baik Allah atau Rasulnya tidak menunjuk orang dari pilihan umat. Pemilihan, secara fitrah, tidak memaksa setiap kaum Muslimin untuk memilih wakil khususnya. Apabila tidak, pemilihan tersebut berarti paksaan. Artinya pemilihan itu akan kehilangan fitrahnya dan menjadi tindakan pemaksaan. Ucapan Nabi yang terkenal menyatakan, “Tidak ada sumpah setia yang sah jika diperoleh dengan paksaan.”

Mari kita lihat apa yang dilakukan Umar pada saat itu.

Sejarahwan Sunni meriwayatkan bahwa ketika Umar sampai di depan pintu rumah Fathimah, ia berkata,

“Demi ,Allah, aku akan membakar (rumah ini) jika kalian tidak keluar dan berbaiat kepada (Abu Bakar)!”(5)

Selain itu, Umar bin Khattab datang ke rumah Ali. Talhah dan Zubair serta beberapa kaum Muhajirin lain juga berada di rumah itu.

Umar berteriak,

“Demi Allah, keluarlah kalian dan baiat Abu Bakar jika tidak akan kubakar rumah ini.” Zubair keluar dengan pedang terhunus, karena ia terjatuh (kakinya tersandung sesuatu), pedangnya lepas dari tangannya, merekapun menerkamnya dan membekuknya.(6)

Abu Bakar, berdasarkan sumber riwayat yang shahih, berkata bahwa ketika umat telah berbaiat padanya setelah Nabi Muhammad wafat, Ali dan Zubair sering pergi ke Fathimah Zahra, putri Nabi Muhammad, untuk bertanya.

Ketika berita ini diketahui Umar, ia pergi ke rumah Fathimah dan berkata,

“Wahai putri Rasulullah! Aku tidak mencintai seorang pun sebanyak cintaku pada ayahmu, dan tidak ada seorang pun setelahnya yang lebih aku cintai selain engkau. Tetapi, Demi Allah, sekiranya orang-orang ini berkumpul bersamamu, kecintaan ini tidak akan mencegahku untuk membakar rumahmu.”(7)

Diriwayatkan pula bahwa Umar berkata kepada Fathimah (yang berada di belakang pintu),

“Aku mengetahui bahwa Rasulullah tidak mencintai siapa pun lebih dari cintanya padamu. Tetapi kehendakku tidak akan menghentikanku melaksanakan keputusanku. Jika orang-orang ini berada di rumahmu, aku akan membakar pintu ini di hadapanmu.”(8)

Sebenarnya Syilbi Numani sendiri menyaksikan peristiwa di atas dengan kata-kata berikut:

“Dengan sifat Umar yang pemarah, perbuatan tersebut sangat tidak mungkin dilakukan.”9

Diriwayatkan pula bahwa Abu Bakar berkata menjelang kematiannya,

“Andai saja aku tidakpergi ke rumah Fathimah dan mengirim orang-orang untuk menyakitinya, meskipun hal itu akan menimbulkan peperangan jika rumah tersebut tetap digunakan sebagai tempat berlindung.”(10)

Sejarahwan menyebutkan nama-nama berikut adalah orang-¬orang yang menyerang rumah Fathimah untuk membakar orang-orang yang berlindung di dalamnya; Umar bin Khatab, Khalid bin Walid, Abdurrahman bin Auf, Tsabit bin Shammas, Ziyad bin Labid, Muhammad bin Maslamah, Salamah bin Salim bin Waqqash, Salamah bin Aslam, Usaid bin Huzair, Zaid bin Tsabit.

Ulama Sunni yang ditakzimkan, Abu Muhammad bin Muslim bin Qutaibah Dainuri dalam kitab al-Imamah wa as-Siyasah meriwayatkan bahwa Umar meminta sebatang kayu dan berkata kepada orang orang yang berada di dalam rumah, “Aku bersumpah demi Allah yang menggenggam jiwaku, jika kalian tidak keluar, akan aku bakar rumah ini!” Seseorang memberitahu Umar bahwa Fathimah berada di dalam. Umar berteriak, “Sekalipun! Aku tidak peduli siapa pun yang berada di dalam rumah itu.”(11)

Baladzuri, seorang sejarahwan lain meriwayatkan bahwa Abu Bakar meminta Ali untuk memberi dukungan kepadanya tetapi Ali menolak. Kemudian Umar berjalan ke rumah Ali sambil membawa kayu bakar di tangannya. Ia bertemu Fathimah di muka pintu. Fathimah berkata, “Engkau berniat membakar pintu rumahku?” Umar menjawab, “Ya, karena hal ini akan menguatkan agama yang diberikan kepada kami dari ayahmu.”(12)

Dalam kitabnya, Jauhari berkata bahwa Umar dan beberapa kaum Muslimin pergi ke rumah Fathimah untuk membakar rumahnya dan orang-orang di dalamnya yang menentang. Ibnu Shahna menambahkan, “Membakar rumah serta penghuninya.”

Lebih jauh lagi diriwayatkan bahwa ketika Ali dan Abbas sedang duduk di dalam rumah Fathimah, Abu Bakar berkata kepada Umar, “Pergi dan bawalah mereka, jika mereka menentang, bunuh mereka!” Umar membawa sepotong kayu bakar untuk membakar rumah tersebut. Fathimah keluar dari pintu dan berkata, “Hai putra Khattab, apakah kamu datang untuk membakar rumah yang di dalamnya terdapat aku dan anak¬-anakku?” Umar menjawab, “Ya, demi Allah, hingga mereka keluar berbaiat kepada khalifah Rasul.”(13)

Semua orang keluar dari rumah kecuali Ali. Ia berkata, “Aku bersumpah akan tetap berada di rumahku sampai aku selesai mengumpulkan Quran.”

Umar tidak terima tetapi Fathimah membatahnya hingga ia berbalik. Umar menghasut Abu Bakar untuk menyelesaikan masalah tersebut. Abu Bakar kemudian mengirim Qunfiz (budaknya) tetapi selalu menerima jawaban negatif setiap kali ia menemui Ali. Akhirnya, Umar pergi dengan sekelompok orang ke rumah Fathimah.

Ketika Fathimah mendengar suara mereka, ia berteriak keras,

“Duhai ayahku, Rasulullah! Lihatlah bagaimana Umar bin Khattab dan Abu Bakar memperlakukan kami setelah engkau tiada! Lihatlah bagaimana cara mereka menemui kami!”

Ulama-ulama Sunni seperti Ahmad bin Abdul Aziz Jauhari dalam bukunya Saqifah, Abu Wahid Muhibuddin Muhammad Syahnah Hanafi dalam bukunya Syarh al-Nahj, dan lainnya telah meriwayatkan peristiwa yang sama.

Lihat juga sejarahwan terkemuka Sunni, Abdul Hasan, Ali bin Husain Mas’udi dalam bukunya Ishabat al-Wasiyyah, menjelaskan peristiwa tersebut secara terperinci dan meriwayatkan, “Mereka mengelilingi Ali dan membakar pintu rumahnya, melemparkannya serta mendorong penghulu seluruh perempuan (Fathimah) ke dinding yang menyebabkan terbunuhnya Muhsin (putra berusia 6 bulan yang tengah dikandungnya).

Shalahuddin Khalil Safadi, ulama Sunni lain, dalam kitabnya Wafi al-Wafiyyat, pada surat ‘A’ ketika mencatat pandangan/pendapat Ibrahim bin Sayar bin Hani Basri, yang terkenal dengan nama Nidzam mengutip bahwa ia berkata,

“Pada hari pembaiatan, Umar memukul perut Fathimah sehingga bayi dalam kandungannya meningggal.”

Menurut anda mengapa perempuan muda berusia 18 tahun harus terpaksa berjalan ditopang tongkat? Kekerasan serta tekanan yang sangat hebat menyebabkan Sayidah Fathimah Zahra senantiasa menangis, “Bencana itu telah menimpaku sehingga sekiranya bencana itu datang di siang hari, hari akan menjadi gelap.” Sejak itu Fathimah jatuh sakit hingga wafatnya akibat bencana dan sakit yang menimpanya, padahal usianya baru 18 tahun.

Seperti yang dikutip oleh Ibnu Qutaibah menjelang hari–hari terakhirnya, Fathimah selalu memalingkan wajahnya ke dinding, ketika Umar dan Abu Bakar datang membesuknya menjawab ucapan mereka yang mendoakan kesembuhannya, Fathimah mengingatkan Umar dan Abu Bakar tentang pernyataan Nabi Muhammad bahwa barang siapa yang membuat Fathimah murka, maka ia telah membuat murka Nabi.

Fathimah berkata,

“Allah dan malaikat menjadi saksiku bahwa engkau membuatku tidak ridha, dan kalian telah membuatku murka. Apabila aku ber¬temu ayahku, akan kuadukan semua perbuatan kalian berdua!”(14)

Karena alasan yang sama, Fathimah ingin agar kedua orang yang telah menyakitinya jangan sampai hadir di pemakamannya dan oleh karenanya ia dimakamkan malam hari. Bukhari, dalam kitabnya menegaskan bahwa Ali menuruti keinginan istrinya. Bukhari meriwayatkan dari Aisyah bahwa Fathimah sangat marah kepada Abu Bakar sehingga ia menjauhinya, tidak berbicara dengannya sampai wafatnya. Fathimah hidup selama 6 bulan setelah Nabi Muhammad wafat. Ketika Fathimah wafat, suaminya Ali menguburkannya di malam hari tanpa memberitahukan Abu Bakar dan melakukan shalat jenazah sendiri.(l5 )

Usaha apa pun yang mereka lakukan, mereka tidak dapat menemukan makamnya. Makam Fathimah hanya diketahui oleh keluarga Ali. Hingga saat ini makam putri Nabi Muhammad yang tersembunyi merupakan tanda-tanda ketidaksukaannya kepada beberapa sahabat.

Pendapat Nabi Muhammad terhadap Orang-orang yang Menyakiti Fathimah

Nabi Muhammad sudah berulang kali mengatakan,

“Fathimah adalah bagian dari diriku. Barangsiapa membuatnya murka, ia telah membuatku murka!”(16)

PENUTUP…:

ORANG GILA MANA YANG BERANI MAIN2 DENGAN MURKANYA NABI SAWW TAPI NGGA PUNYA MALU NGAKU CINTA NABI ?

Catatan Kaki :

1. Lihat Shahih Bukhari, versi Arab-Inggris, jilid 8, hadis 8.17.

2. Referensi hadis Sunni: Bukhari, Arab-Inggris, vol. 8, hadis 8.17.

3. Referensi hadis Sunni: Musnad Ahmad ibn Hanbal, jilid 1, hal. 55; Sirah aai-Nabawiyyah oleh Ibnu Hisyam, jilid 4, ha1.309; Tarikh ath-Thabari, jilid 1, hal. 1822; Tarikh ath-Thabari, versi bahasa Inggris, jilid 9, hal. 192.

4. Referensi hadis Sunni: Tarikh ath-Thabari, versi bahasa Inggris, jilid 9, ha1.188-189.

5. Referensi hadis Sunni: Tarikh ath-Thabari (bahasa Arab), jilid 1, hal. 1118-1120; Tarikh, Ibnu Atsir, jilid 2, hal. 325; al-Isti’ab oleh Ibnu Abdil Barr, jilid 3, hal. 975; Tarikh al-Khulafa oleh Ibnu Qutaibah, jilid 1, hal. 20; al-Imamah wa as-Siyasah oleh Qutaibah, jilid 1, ha1.19-20.

6. Referensi hadis: Tarikh ath-Thabari, versi bahasa Inggris, jilid 9, ha1.186¬187. Pada catatan kaki di halaman yang sama (ha1.187) penerjemahnya memberi komentar, “Meskipun waktunya tidak jelas, nampaknya Ali dan kelompoknya mengetahui tentang peristiwa di Saqifah setelah apa yang terjadi di sana. Para pendukungnya berkumpul di rumah Fathimah. Abu Bakar dan Umar sangat menyadari tuntutan Ali. Karena takut ancaman serius dari pendukung Ali, Umar mengajaknya ke masjid untuk memberi sumpah setia. Ali menolak, sehingga rumah tersebut dikelilingi oleh pasukan pimpinan Abu Bakar-Umar, yang mengancam akan membakar rumah sekiranya Ali dan pengikutnya tidak keluar dan memberi sumpah setia kepaLta Abu Bakar. Keadaan bertambah panas dan Fathimah marah. Lihat Ansab Asyraf oleh Baladzuri dalam kitabnya jilid 1, ha1.582-586; Tarikh Ya’qubi, jilid 1, ha1.116, al-Imamah wn as-Siyasah oleh Ibnu Qutaibah, jilid 1, hal. 19-20.

7. Referensi hadis Sunni: Tarikh ath-Thabari, pada peristiwa tahun 11 H; al-Imamah wa as-Siyasah oleh Ibnu Qutaibah, jilid 1, pengantar isi, dan ha1.19-20; Izalat al-Khalifah oleh Syah Wahuilah Muhaddis Dehlavi, jilid 2, hal. 362; Iqd al-Farid oleh Ibnu Abdurrabbah Malik, jilid 2, bab Saqifah.

8. Referensi hadis Sunni: Kanz al-Ummal, jilid 3, hal. 140.

9. Referensi hadis Sunni: al-Faruq oleh Syibli Numani, hal. 44.

10. Referensi hadis Sunni: Tarikh al-Ya’qubi, jilid 2, ha1.115-116; Asab Asyraf oleh Baladzuri, jilid 1, hal. 582, 586.

11. Referensi hadis Sunni: al-Imamah wa as-Siyasah oleh Ibnu Qutaibah, jilid 1, hal. 3, 19-20.

12. Referensi hadis Sunni: al-Ansab Asyraf oleh Baladzuri, jilid 1, ha1.582, 586.

13. Referensi hadis Sunni: Iqd al-Farid oleh Ibnu Abdurrabbah, bagian 3, ha1.63; al-Ghurar oleh Ibnu Khazaben, bersumber dari Zaid Ibnu Aslam.

14. Al-Imamah wa as-Siyasah oleh Ibnu Qutaibah, jilid 1, hal.4.

15. Referensi hadis Sunni: Shahih Bukhari, bab Perang Khaibar, Arab ¬Inggris jilid 5; Tarikh Thabari, jilid IX, ha1.196 (peristiwa tahun 11, versi bahasa Inggris); Tabaqat ibn Sa’d, jilid. VIII, ha1.29; Tarikh, Ya’qubi, jilid II, hal.117; Tanbih, Mas’udi, hal. 250 (kalimat ketiga terakhir disebutkan di catatan kaki kitab Thabari); Baihaqi, jilid 4, hal. 29; Musnad, Ibnu Hanbal, jilid 1, hal. 9; Tarikh, Ibnu Katsir, jilid 5, hal. 285-86; Syarh ibn al-Hadid, jilid 6, hal. 46. 546, hal. 381-383 juga pada jilid 4, hadis 325.

16. Referensi hadis Sunni: Shahih Bukhari, Arab-Inggris, jilid 5, hadis 61 dan 111; Shahih Muslim, bab Keutamaan Fathimah, jilid 4, ha1.1904-5.

Al-Mustafa : Manusia Pilihan Yang Disucikan

Sat, Mar 27th 2010, 11:59

Prof Jalaluddin Rakhmat:

Berilah Hadiah untuk Nabi

.
BANDA ACEH –
Tiap kali memperingati Maulid Nabi Muhammad saw, seorang muslim yang mengaku mencintai Baginda Nabi sudah sepantasnya memberikan hadiah untuk Penghulu Alam tersebut. Kebiasaan demikian akan menumbuhkan rasa cinta terhadapnya. Hadiah dimaksud sesuai dengan kadar kemampuan dan kecintaan seseorang kepada nabinya. Demikian dikatakan Prof Dr KH Jalaluddin Rakhmat, Jumat (26/3) malam dalam ceramah maulid di Masjid Jamik Almakmur, Lampriek, Banda Aceh
.
Jalaluddin Rakhmat yang populer dengan sapaan “Kang Jalal” itu mengaku dirinya sudah mulai membiasakan diri memberi hadiah atas kelahiran nabi dengan menulis buku tentang Nabi Muhammad. Diakuinya, setiap peringatan maulid, sebuah buku selalu dia terbitkan dan dihadiahkan kepada muslimin sebagai wujud cintanya kepada Nabi Muhammad. “Buku yang saya tulis pada peringatan maulid kali ini berjudul Mengapa Sang Nabi Menangis?” katanya.Sebelumnya, buku berjudul Al Mustafa ditulis Kang Jalal sebagai hadiah dalam memperingati maulid Nabi Muhammad saw
.
Kang Jalal dalam ceramah tadi malam tampil sederhana di hadapan ratusan jemaah. Bahkan cendekiawan muslim itu, sempat meminta maaf jika dirinya tampil tidak memakai peci atau serban seperti ulama atau teungku lainnya di Aceh. Dalam paparannya lebih dari satu jam itu, Kang Jalal mengemukakan berbagai cerita hikmah diperingatinya maulid nabi. Termasuk, informasi peringatan maulid di seluruh dunia muslim.  Disebutkan, ada tiga ciri diperingatinya maulid nabi di seluruh dunia. Pertama, dalam peringatan maulid selalu dibacakan riwayat kelahiran Nabi Muhammad. Kedua, selalu dibacakan selawat, ketiga selalu dibagikan makanan bagi setiap jemaah yang hadir
.
Ketiga ciri tersebut, menurut Kang Jalal, berlaku umum di semua negara muslim, termasuk di Aceh. “Jadi, jika tiga ciri itu ada saat ini, maka sudah sesuailah peringatan malam ini,” katanya menyindir panitia pelaksana untuk menyiapkan hidangan selesai acara tersebut dan disambut tawa jemaah. Kang Jalal juga mengajak kepada seluruh muslimin di Aceh bersama-sama berbuat dalam rangka mewujudkan rasa cinta kepada Nabi Muhammad dengan beragam cara.Kang Jalal juga mengupas pro-kontra peringatan maulid yang selalu diperbincangkan muslimin saat ini. Dia mengaku, sejak awal selalu anti terhadap peringatan maulid, namun setelah melakukan telaah mendalam dari berbagai aspek dan pendekatan, Kang Jalal mulai memperingati maulid sebagai sikap rasa cinta kepada Nabi Muhammad
.
Ceramah memperingati maulid nabi tersebut berlangsung khidmat. Suasananya jauh beda dengan peringatan maulid yang biasanya berlangsung di Aceh. Penampilan Kang Jalal persis acara kuliah umum (stadium general) mahasiswa di kampus. Berlangsung cukup ilmiah dan tidak membosankan. Selama pemaparan itu, Kang Jalal sesekali berguyon sehingga suasana di dalam Masjid Agung Banda Aceh itu tidak membosankan
.

Penampilan Kang Jalal tadi malam merupakan kali kedua di Aceh setelah peristiwa tsunami Desember 2004. Sebelumnya Kang Jalal pernah ke Aceh sebagai relawan kemanusiaan. Menurut Kang Jalal, orang tuanya dulu pernah menemui Tgk Daud Beureueh pada masa pergolakan dan mencari jalan keluarnya. “Karena orang tua saya dulu pernah kemari bertemu Daud Beureuh, maka kehadiran saya kali ini merupakan penyambung silaturahmi yang dirintis orang tua saya dulu,” ujarnya saat menutup ceramah di Masjid Al Makmur malam kemarin

.

Selain ceramah, peringatan maulid Nabi yang digagas Badan Musyawarah Perbankan Daerah (BMPD) Aceh itu, pagi ini seusai shalat subuh juga digelar diskusi di Café Tower, Banda Aceh.

mengkritisi hadis dan tarikh Rasulullah saw versi Sunni

K.H. Jalaluddin Rakhmat

Imam Ahmad bin Hanbal adalah seorang pemuka mazhab Ahlus Sunnah yang besar. Ia terkenal sebagai muhaddits (periwayat hadis). Kedalaman ilmunya dan keluasan pengaruhnya di kalangan kaum Muslimin sangat disegani Khalifah Al-Mutawakkil

.

Imam Ahmad sering dimintai nasihat dalam menunjukkan hakim-hakim (qadhi) kerajaan. Ketika Al-Mutawakkil hendak mengangkat Al-Tsalji sebagai qadhi, Imam Ahmad merasa keberatan. “Jangan angkat dia, karena dia pembuat bid’ah dan penurut hawa nafsu,” kata Imam Ahmad. Al-Mutawakkil memperhatikan sarannya

.

Karena ketinggian martabatnya di hadapan raja, para ulama lain merasa irihati terhadapnya (Ah, betapa sering orang menutupi kerendahan akhlak dengan jubah ulama!). Mereka mencari jalan untuk mendiskreditkan Imam Ahmad

.

Dikatakan kepada Al-Mutawakkil bahwa Imam Ahmad itu Syi’ah, membaiat. pengikut Ali, dan melindungi seorang ‘Alawi di rumahnya. Waktu itu, tidak ada tuduhan yang lebih berat daripada itu. Al-Mutawakkil mengirim tentara

.

Rumah Imam Ahmad dikepung. “Tuduhan ini dibuat-buat. Aku tidak tahu-menahu,” kata Imam Ahmad, “Aku menaati raja dalam suka dan duka.” Lalu ia disuruh bersumpah bahwa ia tidak melindungi pengikut Ali di rumahnya

.

Rumah Imam Ahmad kemudian digeledah — kamar anak-anak, kamar wanita, bahkan sumur. Tidak ada bukti apa pun tentang ke-Syi’ah-an Imam Ahmad

.

Sejarah, memang, tidak pernah mencatat Imam Ahmad sebagai Syi’ah. Ia pemuka mazhab Hambali. Lalu apa salah beliau? “Salah”-nya sedikit: di dalam Musnad Ahmad-nya, ia banyak meriwayatkan hadis-hadis tentang keutamaan Ahlul-Bait dan Ali bin Abi Thalib (karramallahu wajhah). Abdullah, putra Imam Ahmad, pernah berkata: Aku mendengar ayahku (Imam Ahmad) berkata: “Tidak ada seorang pun di antara para Sahabat yang memiliki fadha’il (keutamaan) dengan sanad-sanadnya yang shahih seperti Ali bin Abi Thalib.”

.

Menganggap Ali bin Abi Thalib sebagai sahabat paling utama adalah keyakinan Syi’ah. Begitu anggapan umum, waktu itu. Orang membuktikan ke-Syi’ahan seseorang dengan menanyakan siapa yang paling utama di antara para sahabat

.

Ahlus-Sunnah akan menyebut dengan urutan Abu Bakar, Umar, Utsman, Ali, dan seterusnya. Sedangkan Syi’ah akan memulai urutan pertama sahabat itu dari Ali

.

Pada suatu kali, Abdullah bin Ahmad bin Hambal menanyai ayahnya, “Bagaimana pendapat Anda tentang tafdhil (urutan keutamaan) sahabat?” Ahmad bin Hambal menjawab, “Dalam khilafah: Abu Bakar, Umar, Utsman.”

.

“Lalu bagaimana. dengan Ali?” tanya Abdullah.

.

“Wahai anakku,”• kata Ahmad bin Hambal, “Ali bin Abi Thalib termasuk Ahlul-Bait dan orang tidak dapat diperbandingkan dengan mereka!

.

Pada kali yang lain, serombongan orang datang menyelidik, “Hai Abu Abdullah, bagaimana pendapat Anda tentang hadis – Ali pembagi neraka?

.

Ahmad :Lalu apa yang kalian tolak? Bukankah Nabi s.a.w. pernah berkata kepada Ali: “Tidak mencintaimu kecuali mukmin, dan tidak membencimu kecuali munafik.”

.

Orang-orang : Betul (Nabi Saw berkata begitu).

.

Ahmad : Di mana orang mukmin menetap?

Orang-orang : Di surga.

Ahmad : Di mana orang munafik menetap?

Orang-orang : Di neraka.

Ahmad : Kalau. begitu, Ali adalah pembagi neraka.

.

Pernyataan-pernyataan Imam Ahmad inilah yang memperkuat tuduhan Syi’ah kepadanya. Bukankah Syi’ah adalah mazhab yang mengikuti Ahlul-Bait — dengan Ali sebagai rujukannya. Lagi pula Ahmad bin Hambal banyak meriwayatkan hadis dari perawi-perawi yang bermazhab Syi’ah. Salah seorang gurunya yang dihormatinya adalah Abdurrahman bin Shalih, seorang Syi’ah. Ahmad bin Hambal diperingatkan untuk tidak bergaul dengannya. Tetapi ia membentak, “Subhanallah, kepada orang yang mencintai keluarga suci Nabi kita berkata — jangan mencintainya? Abdurrahman bin Shalih adalah tsiqat (orang yang dapat dipercaya).

.

Tuduhan Syi’ah terhadap Ahmad bin Hambal ini untungnya tidak berakibat parah. Rumahnya digeledah dan ditinggalkan. Ahmad bin Hambal tetap mengajar seperti biasa. Lain halnya dengan Imam Syafi’i. Beliau beserta 300 orang Quraisy diseret dalam keadaan terbelenggu dari Yaman (menurut suatu riwayat, dari Makkah) ke Baghdad. Mereka dihadapkan kepada Harun Al-Rasyid. Seorang demi seorang dipancung di depan Khalifah.

.

Imam Syafi’i selamat, setelah ia mengucapkan salam kepada Harun Al-Rasyid. Ia sempat menasihati raja dan membuatnya menangis. Begitu, kata sahibul-hikayat. Kita tidak tahu apa yang sebetulnya terjadi karena riwayat mihnah Imam Syafi’i ini bermacam-macam. Yang disepakati ialah kenyataan bahwa salah satu tuduhan kepada Imam Syafi’i ialah bahwa ia Syi’ah. Sebagian penyair mengejek Imam Syafi’i:

.

Mati Syafi’i dan ia tak tahu

Apakah Tuhannya Ali, atau Allah

.

Imam Syafi’i tentu saja tidak menganggap Ali sebagai Tuhan. Kalau Syi’ah diartikan sebagai mazhab yang menganggap khilafah adalah hak Ali, maka Imam Syafi’i bukanlah Syi’ah. “Jika Syi’ah berarti mencintai keluarga Muhammad,” kata Imam Syafi’i dalam salah satu bait, syairnya, “maka hendaknya kedua kelompok menjadi saksi bahwa aku ini Syi’ah.” Imam Syafi’i menggunakan kata “Rafidhi” untuk menyebut Syi’ah – gelaran yang lazim diberikan orang di zaman itu bagi pengikut Syi’ah.

.

Imam Syafi’I banyak menulis syair yang mengungkapkan kecintaannya kepadaAhlul-Bait. Beberapa di antaranya kita kutipkan di sini:

Kalau kulihat manusia

mazhab mereka tenggelam dalam samudera kesesatan dan kebodohan

dengan nama Allah aku naiki perahu keselamatan

yakni keluarga al-Musthafa, penutup para rasul

Kupegang tali Allah tempat bergantung mereka

Sebagaimana kita pun diperintah berpegang pada tali itu

Hai keluarga Rasulullah

kecintaan kepadamu diwajibkan Allah

dalam Al-Quran yang diturunkan

Cukuplah bukti ketinggian sebutanmu

Tidak sempurna shalat tanpa shalawat bagimu

.

Inilah sebagian syair Imam Syafi’i, yang menyebabkannya dituduh Syi’ah. Ahli jarhhadis, Ibn Mu’in, ketika ditanya oleh Imam Ahmad mengapa ia menuduh Imam Syafi’i sebagai Syi’ah, menjawab: “Aku memperhatikan tulisannya tentang ahlul-baghiy (kaum pemberontak), dan aku melihat ia berhujjah dari awal sampai akhir dengan Ali bin Abi Thalib.” Rupanya, ini juga sebabnya mengapa di tempat lain – menurut Al-Khathib – Yahya bin Mu’in berkata, “Syafi’i tidak tsiqat!”

.

Celaan-celaan demikian tidak mengurangi kecintaan Imam Syafi’i kepada ahlu-bait. Suatu hari ia mengemukakan masalah agama.

.

Seseorang berkata, “Engkau bertentangan dengan Ali bin Abi Thalib.” Imam Syafi’i berkata, “Buktikan ucapanmu dari Ali bin Abi Thalib, supaya aku ratakan pipiku di atas tanah dan aku berkata aku telah salah.” Begitu cintanya Imam Syafi’i kepada Ali bin Abi Thalib, sehingga ia tidak mau berbicara di dalam suatu majelis yang di situ ada. keturunan Ali (Lihat Fihrist Ibn Al-Nadim, halaman 295).

.

Kita tidak ingin menguraikan lebih lanjut kecintaan para imam Ahlus-Sunnah kepada ahlul-bait. Tidak perlu juga kita sebut bagaimana Abu Hanifah (Imam Hanafi) membantu pemberontakan ahlul-bait yang dipimpin Imam Zaid bin Ali; sehinga para. ulama mengatakan, “Secara fiqh Abu Hanifah Sunni; secara politik, ia Syi’ah.”

.

Tentu saja, label (gelaran) Syi’ah lebih sering digunakan untuk mendiskreditkan orang ketimbang mendiskripsikannya.

.

Indikator yang dipergunakan seringkali sangat sederhana: kecintaan kepada keluarga. Rasulullah Saw.

.

Al-Hakim, penulis Al-Mustadrak, dituding oleh Al-Dzahabi sebagai Syi’ah, karena meriwayatkan keutamaan Ali dan hadis Ghadir Khum

Abdur-Razzaq bin Hamam, ahli hadis, dituduh Syi’ah karena mencintai Ali dan membenci pembunuhnya.

.

Ibn Jarir Al-Thabari penulis sejarah Islam abad ketiga, menurut Ibn Atsir (Al-Kamil8:49), dilempari dengan batu dan dikuburkan malam-malam. Ia juga dituduh Syi’ah karena dalam tarikhnya ia meriwayatkan hadis Ali bin Abi Thalib sebagaiwashiy (pembawa wasiat) dan khalifah Nabi s.a.w.

.

Yang paling menarik, Ibn Abdul-Barr, yang sangat memusuhi ahlul-bait dituding oleh Ibn Katsir sebagai Syi’ah karena meriwayatkan hadis yang mengecam Mu’awiyah.

.

Buku ini, Teladan Suci Keluarga Nabi, terjemahan dari Is’af Al-Raghibin, ditulis oleh seorang ‘alim yang bermazhab Syafi’i, dan Ahlus-Sunnah wal-Jama’ah. Dalam buku ini ia meriwayatkan keutamaan keluarga Rasulullah Saw. dari hadis-hadis yang diriwayatkan dalam kitab-kitab Ahlus-Sunnah.

.

Boleh jadi ia, dan juga penulis pengantar ini, akan didiskreditkan sebagai Syi’ah: hanya karena meriwayatkan ahlul-bait. Namun, kita yakin, zaman ini adalah zaman ilmu pengetahuan, zaman keterbukaan. Hanya orang-orang yang sempit pikirannya yang akan menyederhanakan persoalan dalam prasangka dan fanatisme mazhab.

.

Kecintaan pada ahlul-bait bukan monopoli Syi’ah. Seluruh kaum Muslimin diperintahkan untuk itu – apa pun mazhabnya. Seperti diriwayatkan Muslim – dan dituliskannya juga dalam buku ini – keluarga Rasulullah s.a.w. adalah pusaka yang kedua (setelah Al-Quran) yang ditinggalkan Rasulullah s.a.w. untuk kaum Muslimin.

.

Rasulullah Saw bersabda, “Tidak akan bergeser telapak kaki anak Adam pada hari kiamat sampai ia ditanya tentang 4 hal: dari usianya, untuk apa ia habiskan, dari tubuhnya, untuk apa ia rusakkan; dari hartanya, dari mana ia peroleh dan ke mana ia infaq-kan; dan dari kecintaan kepada kami ahlul-bait.” (Kanzul-Ummal 7: 212); diriwayatkan oleh Al-Thabrani dalam Al-Kabir dan Al-Ausath).

.

Ibn Khalliqan dalam Wafiyat Al-A’yan bercerita tentang Al-Nasa-i, penulis kitab hadis Sunan Al-Nasa-i. Al-Nasa-i tiba di Damaskus. Ia didesak orang untuk meriwayatkan keutamaan Mu’awiyah. Kata Al-Nasa-i, “Aku tidak menemukan keutamaan Mu’awiyah kecuali sabda Rasul tentang dirinya – “Semoga Allah tidak mengenyangkan perutnya.” Banyak orang marah. Mereka mengeroyoknya, memukulinya sampai babak-belur Dalam keadaan parah, ia dibawa ke Al-Ramlah dan meninggal dunia di sana.

.

Ibnu Hajar di dalam Tandzib Al-Tandzib bercerita tentang Nashr bin Ali. Ia meriwayatkan hadis tentang keutamaan Hasan dan Husein: “Siapakah yang mencintai aku, mencintai keduanya, mencintai kedua orangtua mereka , ia bersamaku dalam derajat yang sama di hari kiamat.” Al-Mutawakkilmencambuknya 1.000 kali.

.

Ja’far bin Abdul-Wahid berulang kali mengingatkan Khalifah: “Hadza min Ahlis-Sunnah” (Dia ini dari Ahlus Sunnah). Barulah Khalifah menghentikan hukuman cambuknya.

.

Hari ini, umat Islam telah demikian maju dan terbuka, sehingga – saya (Jalaluddin Rakhmat) berharap – penulis pengantar, penerbit, dan pembaca buku ini tidak mengalami nasib, seperti Al-Nasa-i dan Nashr bin Ali.

.
Ketika Karen Armstrong menulis Muhammad: Prophet of Our Time, ia mengisi salah satu babnya dengan ayat-ayat setan. Karena ia pernah belajar sastra inggris, Armstrong menggunakan teknik-teknik cerita yang dramatis. Seorang muslim Indonesia yang tinggal di Amerika terkagum-kagum dengan tulisan Armstrong. Ia dipuji sebagai orang barat yang memberikan pengertian yang benar tentang Nabi Muhammad dan agama Islam. Ketika ia membaca terjemahannya dalam bahasa Indonesia, ia membaca kata pengantar dari KH. Jalaluddin Rakhmat yang biasa di panggil dengan Kang Jalal ini. “Saya baru tahu bahwa selama ini saya tidak bisa kritis membaca tarikh Nabi,” katanya dalam blognya di internet. Dalam pengantar buku itu Kang Jalal menulis:

“Para penguasa politik menciptakan naratif Nabi yang sesuai dengan kepentingan politiknya. Para pendusta yang tampak saleh mencemari naratif Nabi dengan imajinasinya. Dongeng-dongeng mereka masuk ke dalam perbendaharaan hadis. Hadis adalah berita tentang perkataan, perbuatan, ketetapan, dan sifat-sifat –fisik dan mental — yang dinisbahkan kepada Nabi SAW. Hadis adalah bahan utama tarikh Nabi. Bila sebagian sumber hadis adalah rekaan para penguasa dan para pendusta, apa yang terjadi pada tarikh Nabi?

Kita menemukan naratif Nabi yang tidak menggambarkan kesucian, kemuliaan, dan keagungan Nabi. Bayangkan biografi Anda ditulis oleh musuh-musuh Anda? Kisah-kisah Nabi seperti itu bertebaran pada kitab-kitab hadis dan tarikh. Kaum Munafik membacanya dengan senang. Peneliti non-Muslim berusaha memahaminya dengan latar belakang kebudayaannya.”

Jika kita tersinggung dengan naratif Salman Rushdie, kenapa kita tidak sakit hati dengan cerita-cerita Nabi yang melecehkan kemuliaannya; hanya karena kisah-kisah itu terdapat dalam kitab kuning atau disampaikan oleh ustaz-ustaz dan kiyai-kiyai yang soleh. Tentu saja tersinggung dengan mengadakan demonstrasi hanya akan mengantarkan penghina Islam dalam ketenaran global. Kisah itu akan terus diulangi. Alih-alih logika kekuatan, kita harus menggunakan kekuatan kekuatan logika. Buktikan bahwa kisah-kisah itu tidak bisa dinisbahkan kepada Manusia Pilihan, yang disapa Tuhan dengan indah: Innaka la’ala khuluqin azhim! Sesungguhnya engkau di atas akhlak yang agung.

Sebagaimana disebutkan dalam kata pengantar buku : Al-Mustafa edisi pertama (Buku yang ditulis oleh Kang Jalal), buku ini ditulis untuk mengembalikan kemuliaan dan kesucian Manusia Pilihan ke dalam cerita besar kita, Our grand narrative. Kaum mukmin yang sejati berusaha untuk menuliskan kisah hidupnya dengan pola kisah Nabi Saw. Celakalah dia, kalau kisah Nabi yang ditirunya, yang menjadi landasan misi hidupnya, adalah kisah yang keliru.

Al-Mushthafa (buku kritik historis sirah nabawiyah versi Jalaluddin Rakhmat)

Tarikh Rasulullah saw sangat penting bagi kaum muslim. Tarikh merupakan kumpulan hadis. Dari hadis, orang-orang yang saleh mengambil sunah yang dijadikan rujukan dalam kehidupan sehari-hari. Dengan merujuk kepada tarikh, kaum muslim menjalankan ibadahnya, mengembangkan akhlaknya, merencanakan perjuangannya, mengarahkan misi dan menetapkan tujuan hidupnya.

Rasulullah saw. adalah Al-Mushthafa, manusia pilihan yang disucikan. Dibandingkan dengan semua nabi dan pendiri agama lainnya, pencatatan kehidupan Nabi Muhammad saw. adalah yang paling lengkap dan paling terperinci.

Sayangnya, dalam perkembangan zaman, orang-orang yang tidak bertanggung jawab telah memasukkan hal-hal yang tidak pantas ada pada diri Rasulullah ke dalam hadis. Berita-berita dusta dinisbatkan kepada Rasulullah saw. Orang awam yang saleh menganggap berita dusta itu hadis dan mereka beragama berdasarkan hadis yang dipercayainya. Untungnya, sepanjang sejarah muncul para ulama yang mengkritisi hadis dan tarikh Rasulullah saw., kadang-kadang dengan risiko dianggap mengingkari sunah Rasul.

Jalaluddin Rakhmat melanjutkan upaya analisis kritis pada tarikh Rasulullah saw. dengan menggunakan metode historis berdasarkan aliran politik perawi hadis. Karena itu, buku ini akan sangat berguna bagi kaum muslim yang ingin menjalankan sunah Rasul yang sahih dan meyakinkan.

Buku AL-MUSHTHAFA ini diterbitkan salah satu penerbit Simbiosa. Terbit pada Mei 2008 dan tebalnya 300 halaman.

DAFTAR ISI:
Mengapa Perlu Studi Kritis?
Abduh: Penyebaran Dusta
Al-Madain: Dampak Kebijakan Muawiyah
Tarikh Nabi saw sebagai Dasar Agama
Kasykul KERANCUAN PENGERTIAN HADIS DAN SUNAH
Kerancuan Pengertian Hadis
Kerancuan Pengertian Sunah
Khatimah

Tarikh Nabi saw dalamTimbangan
Rasulullah adalah Uswatun Hasanah
Riwayat Wahyu Pertama
Pengujian Tarikh Nabi saw. dengan Al-Quran
Kritik Matan Hadis
Kontradiksi dalam Periwayatan Azan
Abu Bakar menjadi Imam salat pada hari-hari terakhir Rasulullah saw.
Metode Historis dalam Kkritik Hadis
Fungsi Analisis Historis.
Analisis Situasi Politik.
Analisis Aliran Politik Rijal

Masyarakat Jahiliah
Situasi Jazirah Arab Secara Geografis
Peranan Perempuan dan Kedudukannya di Zaman Jahiliah
Pengetahuan Arab Jahiliah
Keistimewaan Akhlak Arab Jahiliah

Seputar Masa Muda Al-Mushthafa
Kehidupan Rasulullah saw.
Kisah Bahirah
HARBU AL-FUJJAR (perang orang-orang durhaka)
HILFU AL-FUDHUL (Sumpah Setia)
Pernikahan Dengan Khadijah

Menjelang Bi`tsah
Peristiwa Membangun Kakkbah
Nabi saw. Sangat Pemalu dan Sangat Rendah Hati

10 Versi Turunnya Wahyu yang Pertama Kepada Rasulullah
Siapa sebenarnya Waraqah bin Naufal, Addas, Bahirah dan Nusthur?
Apa yang sahih dalam permulaan wahyu ini?
Jenis-Jenis Wahyu Menurut Al-Quran
Bagaimana datangnya wahyu kepada Rasulullah?

mengkritisi hadis dan tarikh Rasulullah saw versi Sunni

Al-Mustafa : Manusia Pilihan Yang Disucikan

Sat, Mar 27th 2010, 11:59

Prof Jalaluddin Rakhmat:

Berilah Hadiah untuk Nabi

.
BANDA ACEH –
Tiap kali memperingati Maulid Nabi Muhammad saw, seorang muslim yang mengaku mencintai Baginda Nabi sudah sepantasnya memberikan hadiah untuk Penghulu Alam tersebut. Kebiasaan demikian akan menumbuhkan rasa cinta terhadapnya. Hadiah dimaksud sesuai dengan kadar kemampuan dan kecintaan seseorang kepada nabinya. Demikian dikatakan Prof Dr KH Jalaluddin Rakhmat, Jumat (26/3) malam dalam ceramah maulid di Masjid Jamik Almakmur, Lampriek, Banda Aceh
.
Jalaluddin Rakhmat yang populer dengan sapaan “Kang Jalal” itu mengaku dirinya sudah mulai membiasakan diri memberi hadiah atas kelahiran nabi dengan menulis buku tentang Nabi Muhammad. Diakuinya, setiap peringatan maulid, sebuah buku selalu dia terbitkan dan dihadiahkan kepada muslimin sebagai wujud cintanya kepada Nabi Muhammad. “Buku yang saya tulis pada peringatan maulid kali ini berjudul Mengapa Sang Nabi Menangis?” katanya.Sebelumnya, buku berjudul Al Mustafa ditulis Kang Jalal sebagai hadiah dalam memperingati maulid Nabi Muhammad saw
.
Kang Jalal dalam ceramah tadi malam tampil sederhana di hadapan ratusan jemaah. Bahkan cendekiawan muslim itu, sempat meminta maaf jika dirinya tampil tidak memakai peci atau serban seperti ulama atau teungku lainnya di Aceh. Dalam paparannya lebih dari satu jam itu, Kang Jalal mengemukakan berbagai cerita hikmah diperingatinya maulid nabi. Termasuk, informasi peringatan maulid di seluruh dunia muslim.  Disebutkan, ada tiga ciri diperingatinya maulid nabi di seluruh dunia. Pertama, dalam peringatan maulid selalu dibacakan riwayat kelahiran Nabi Muhammad. Kedua, selalu dibacakan selawat, ketiga selalu dibagikan makanan bagi setiap jemaah yang hadir
.
Ketiga ciri tersebut, menurut Kang Jalal, berlaku umum di semua negara muslim, termasuk di Aceh. “Jadi, jika tiga ciri itu ada saat ini, maka sudah sesuailah peringatan malam ini,” katanya menyindir panitia pelaksana untuk menyiapkan hidangan selesai acara tersebut dan disambut tawa jemaah. Kang Jalal juga mengajak kepada seluruh muslimin di Aceh bersama-sama berbuat dalam rangka mewujudkan rasa cinta kepada Nabi Muhammad dengan beragam cara.Kang Jalal juga mengupas pro-kontra peringatan maulid yang selalu diperbincangkan muslimin saat ini. Dia mengaku, sejak awal selalu anti terhadap peringatan maulid, namun setelah melakukan telaah mendalam dari berbagai aspek dan pendekatan, Kang Jalal mulai memperingati maulid sebagai sikap rasa cinta kepada Nabi Muhammad
.
Ceramah memperingati maulid nabi tersebut berlangsung khidmat. Suasananya jauh beda dengan peringatan maulid yang biasanya berlangsung di Aceh. Penampilan Kang Jalal persis acara kuliah umum (stadium general) mahasiswa di kampus. Berlangsung cukup ilmiah dan tidak membosankan. Selama pemaparan itu, Kang Jalal sesekali berguyon sehingga suasana di dalam Masjid Agung Banda Aceh itu tidak membosankan
.

Penampilan Kang Jalal tadi malam merupakan kali kedua di Aceh setelah peristiwa tsunami Desember 2004. Sebelumnya Kang Jalal pernah ke Aceh sebagai relawan kemanusiaan. Menurut Kang Jalal, orang tuanya dulu pernah menemui Tgk Daud Beureueh pada masa pergolakan dan mencari jalan keluarnya. “Karena orang tua saya dulu pernah kemari bertemu Daud Beureuh, maka kehadiran saya kali ini merupakan penyambung silaturahmi yang dirintis orang tua saya dulu,” ujarnya saat menutup ceramah di Masjid Al Makmur malam kemarin

.

Selain ceramah, peringatan maulid Nabi yang digagas Badan Musyawarah Perbankan Daerah (BMPD) Aceh itu, pagi ini seusai shalat subuh juga digelar diskusi di Café Tower, Banda Aceh.

mengkritisi hadis dan tarikh Rasulullah saw versi Sunni

K.H. Jalaluddin Rakhmat

Imam Ahmad bin Hanbal adalah seorang pemuka mazhab Ahlus Sunnah yang besar. Ia terkenal sebagai muhaddits (periwayat hadis). Kedalaman ilmunya dan keluasan pengaruhnya di kalangan kaum Muslimin sangat disegani Khalifah Al-Mutawakkil

.

Imam Ahmad sering dimintai nasihat dalam menunjukkan hakim-hakim (qadhi) kerajaan. Ketika Al-Mutawakkil hendak mengangkat Al-Tsalji sebagai qadhi, Imam Ahmad merasa keberatan. “Jangan angkat dia, karena dia pembuat bid’ah dan penurut hawa nafsu,” kata Imam Ahmad. Al-Mutawakkil memperhatikan sarannya

.

Karena ketinggian martabatnya di hadapan raja, para ulama lain merasa irihati terhadapnya (Ah, betapa sering orang menutupi kerendahan akhlak dengan jubah ulama!). Mereka mencari jalan untuk mendiskreditkan Imam Ahmad

.

Dikatakan kepada Al-Mutawakkil bahwa Imam Ahmad itu Syi’ah, membaiat. pengikut Ali, dan melindungi seorang ‘Alawi di rumahnya. Waktu itu, tidak ada tuduhan yang lebih berat daripada itu. Al-Mutawakkil mengirim tentara

.

Rumah Imam Ahmad dikepung. “Tuduhan ini dibuat-buat. Aku tidak tahu-menahu,” kata Imam Ahmad, “Aku menaati raja dalam suka dan duka.” Lalu ia disuruh bersumpah bahwa ia tidak melindungi pengikut Ali di rumahnya

.

Rumah Imam Ahmad kemudian digeledah — kamar anak-anak, kamar wanita, bahkan sumur. Tidak ada bukti apa pun tentang ke-Syi’ah-an Imam Ahmad

.

Sejarah, memang, tidak pernah mencatat Imam Ahmad sebagai Syi’ah. Ia pemuka mazhab Hambali. Lalu apa salah beliau? “Salah”-nya sedikit: di dalam Musnad Ahmad-nya, ia banyak meriwayatkan hadis-hadis tentang keutamaan Ahlul-Bait dan Ali bin Abi Thalib (karramallahu wajhah). Abdullah, putra Imam Ahmad, pernah berkata: Aku mendengar ayahku (Imam Ahmad) berkata: “Tidak ada seorang pun di antara para Sahabat yang memiliki fadha’il (keutamaan) dengan sanad-sanadnya yang shahih seperti Ali bin Abi Thalib.”

.

Menganggap Ali bin Abi Thalib sebagai sahabat paling utama adalah keyakinan Syi’ah. Begitu anggapan umum, waktu itu. Orang membuktikan ke-Syi’ahan seseorang dengan menanyakan siapa yang paling utama di antara para sahabat

.

Ahlus-Sunnah akan menyebut dengan urutan Abu Bakar, Umar, Utsman, Ali, dan seterusnya. Sedangkan Syi’ah akan memulai urutan pertama sahabat itu dari Ali

.

Pada suatu kali, Abdullah bin Ahmad bin Hambal menanyai ayahnya, “Bagaimana pendapat Anda tentang tafdhil (urutan keutamaan) sahabat?” Ahmad bin Hambal menjawab, “Dalam khilafah: Abu Bakar, Umar, Utsman.”

.

“Lalu bagaimana. dengan Ali?” tanya Abdullah.

.

“Wahai anakku,”• kata Ahmad bin Hambal, “Ali bin Abi Thalib termasuk Ahlul-Bait dan orang tidak dapat diperbandingkan dengan mereka!

.

Pada kali yang lain, serombongan orang datang menyelidik, “Hai Abu Abdullah, bagaimana pendapat Anda tentang hadis – Ali pembagi neraka?

.

Ahmad :Lalu apa yang kalian tolak? Bukankah Nabi s.a.w. pernah berkata kepada Ali: “Tidak mencintaimu kecuali mukmin, dan tidak membencimu kecuali munafik.”

.

Orang-orang : Betul (Nabi Saw berkata begitu).

.

Ahmad : Di mana orang mukmin menetap?

Orang-orang : Di surga.

Ahmad : Di mana orang munafik menetap?

Orang-orang : Di neraka.

Ahmad : Kalau. begitu, Ali adalah pembagi neraka.

.

Pernyataan-pernyataan Imam Ahmad inilah yang memperkuat tuduhan Syi’ah kepadanya. Bukankah Syi’ah adalah mazhab yang mengikuti Ahlul-Bait — dengan Ali sebagai rujukannya. Lagi pula Ahmad bin Hambal banyak meriwayatkan hadis dari perawi-perawi yang bermazhab Syi’ah. Salah seorang gurunya yang dihormatinya adalah Abdurrahman bin Shalih, seorang Syi’ah. Ahmad bin Hambal diperingatkan untuk tidak bergaul dengannya. Tetapi ia membentak, “Subhanallah, kepada orang yang mencintai keluarga suci Nabi kita berkata — jangan mencintainya? Abdurrahman bin Shalih adalah tsiqat (orang yang dapat dipercaya).

.

Tuduhan Syi’ah terhadap Ahmad bin Hambal ini untungnya tidak berakibat parah. Rumahnya digeledah dan ditinggalkan. Ahmad bin Hambal tetap mengajar seperti biasa. Lain halnya dengan Imam Syafi’i. Beliau beserta 300 orang Quraisy diseret dalam keadaan terbelenggu dari Yaman (menurut suatu riwayat, dari Makkah) ke Baghdad. Mereka dihadapkan kepada Harun Al-Rasyid. Seorang demi seorang dipancung di depan Khalifah.

.

Imam Syafi’i selamat, setelah ia mengucapkan salam kepada Harun Al-Rasyid. Ia sempat menasihati raja dan membuatnya menangis. Begitu, kata sahibul-hikayat. Kita tidak tahu apa yang sebetulnya terjadi karena riwayat mihnah Imam Syafi’i ini bermacam-macam. Yang disepakati ialah kenyataan bahwa salah satu tuduhan kepada Imam Syafi’i ialah bahwa ia Syi’ah. Sebagian penyair mengejek Imam Syafi’i:

.

Mati Syafi’i dan ia tak tahu

Apakah Tuhannya Ali, atau Allah

.

Imam Syafi’i tentu saja tidak menganggap Ali sebagai Tuhan. Kalau Syi’ah diartikan sebagai mazhab yang menganggap khilafah adalah hak Ali, maka Imam Syafi’i bukanlah Syi’ah. “Jika Syi’ah berarti mencintai keluarga Muhammad,” kata Imam Syafi’i dalam salah satu bait, syairnya, “maka hendaknya kedua kelompok menjadi saksi bahwa aku ini Syi’ah.” Imam Syafi’i menggunakan kata “Rafidhi” untuk menyebut Syi’ah – gelaran yang lazim diberikan orang di zaman itu bagi pengikut Syi’ah.

.

Imam Syafi’I banyak menulis syair yang mengungkapkan kecintaannya kepadaAhlul-Bait. Beberapa di antaranya kita kutipkan di sini:

Kalau kulihat manusia

mazhab mereka tenggelam dalam samudera kesesatan dan kebodohan

dengan nama Allah aku naiki perahu keselamatan

yakni keluarga al-Musthafa, penutup para rasul

Kupegang tali Allah tempat bergantung mereka

Sebagaimana kita pun diperintah berpegang pada tali itu

Hai keluarga Rasulullah

kecintaan kepadamu diwajibkan Allah

dalam Al-Quran yang diturunkan

Cukuplah bukti ketinggian sebutanmu

Tidak sempurna shalat tanpa shalawat bagimu

.

Inilah sebagian syair Imam Syafi’i, yang menyebabkannya dituduh Syi’ah. Ahli jarhhadis, Ibn Mu’in, ketika ditanya oleh Imam Ahmad mengapa ia menuduh Imam Syafi’i sebagai Syi’ah, menjawab: “Aku memperhatikan tulisannya tentang ahlul-baghiy (kaum pemberontak), dan aku melihat ia berhujjah dari awal sampai akhir dengan Ali bin Abi Thalib.” Rupanya, ini juga sebabnya mengapa di tempat lain – menurut Al-Khathib – Yahya bin Mu’in berkata, “Syafi’i tidak tsiqat!”

.

Celaan-celaan demikian tidak mengurangi kecintaan Imam Syafi’i kepada ahlu-bait. Suatu hari ia mengemukakan masalah agama.

.

Seseorang berkata, “Engkau bertentangan dengan Ali bin Abi Thalib.” Imam Syafi’i berkata, “Buktikan ucapanmu dari Ali bin Abi Thalib, supaya aku ratakan pipiku di atas tanah dan aku berkata aku telah salah.” Begitu cintanya Imam Syafi’i kepada Ali bin Abi Thalib, sehingga ia tidak mau berbicara di dalam suatu majelis yang di situ ada. keturunan Ali (Lihat Fihrist Ibn Al-Nadim, halaman 295).

.

Kita tidak ingin menguraikan lebih lanjut kecintaan para imam Ahlus-Sunnah kepada ahlul-bait. Tidak perlu juga kita sebut bagaimana Abu Hanifah (Imam Hanafi) membantu pemberontakan ahlul-bait yang dipimpin Imam Zaid bin Ali; sehinga para. ulama mengatakan, “Secara fiqh Abu Hanifah Sunni; secara politik, ia Syi’ah.”

.

Tentu saja, label (gelaran) Syi’ah lebih sering digunakan untuk mendiskreditkan orang ketimbang mendiskripsikannya.

.

Indikator yang dipergunakan seringkali sangat sederhana: kecintaan kepada keluarga. Rasulullah Saw.

.

Al-Hakim, penulis Al-Mustadrak, dituding oleh Al-Dzahabi sebagai Syi’ah, karena meriwayatkan keutamaan Ali dan hadis Ghadir Khum

Abdur-Razzaq bin Hamam, ahli hadis, dituduh Syi’ah karena mencintai Ali dan membenci pembunuhnya.

.

Ibn Jarir Al-Thabari penulis sejarah Islam abad ketiga, menurut Ibn Atsir (Al-Kamil8:49), dilempari dengan batu dan dikuburkan malam-malam. Ia juga dituduh Syi’ah karena dalam tarikhnya ia meriwayatkan hadis Ali bin Abi Thalib sebagaiwashiy (pembawa wasiat) dan khalifah Nabi s.a.w.

.

Yang paling menarik, Ibn Abdul-Barr, yang sangat memusuhi ahlul-bait dituding oleh Ibn Katsir sebagai Syi’ah karena meriwayatkan hadis yang mengecam Mu’awiyah.

.

Buku ini, Teladan Suci Keluarga Nabi, terjemahan dari Is’af Al-Raghibin, ditulis oleh seorang ‘alim yang bermazhab Syafi’i, dan Ahlus-Sunnah wal-Jama’ah. Dalam buku ini ia meriwayatkan keutamaan keluarga Rasulullah Saw. dari hadis-hadis yang diriwayatkan dalam kitab-kitab Ahlus-Sunnah.

.

Boleh jadi ia, dan juga penulis pengantar ini, akan didiskreditkan sebagai Syi’ah: hanya karena meriwayatkan ahlul-bait. Namun, kita yakin, zaman ini adalah zaman ilmu pengetahuan, zaman keterbukaan. Hanya orang-orang yang sempit pikirannya yang akan menyederhanakan persoalan dalam prasangka dan fanatisme mazhab.

.

Kecintaan pada ahlul-bait bukan monopoli Syi’ah. Seluruh kaum Muslimin diperintahkan untuk itu – apa pun mazhabnya. Seperti diriwayatkan Muslim – dan dituliskannya juga dalam buku ini – keluarga Rasulullah s.a.w. adalah pusaka yang kedua (setelah Al-Quran) yang ditinggalkan Rasulullah s.a.w. untuk kaum Muslimin.

.

Rasulullah Saw bersabda, “Tidak akan bergeser telapak kaki anak Adam pada hari kiamat sampai ia ditanya tentang 4 hal: dari usianya, untuk apa ia habiskan, dari tubuhnya, untuk apa ia rusakkan; dari hartanya, dari mana ia peroleh dan ke mana ia infaq-kan; dan dari kecintaan kepada kami ahlul-bait.” (Kanzul-Ummal 7: 212); diriwayatkan oleh Al-Thabrani dalam Al-Kabir dan Al-Ausath).

.

Ibn Khalliqan dalam Wafiyat Al-A’yan bercerita tentang Al-Nasa-i, penulis kitab hadis Sunan Al-Nasa-i. Al-Nasa-i tiba di Damaskus. Ia didesak orang untuk meriwayatkan keutamaan Mu’awiyah. Kata Al-Nasa-i, “Aku tidak menemukan keutamaan Mu’awiyah kecuali sabda Rasul tentang dirinya – “Semoga Allah tidak mengenyangkan perutnya.” Banyak orang marah. Mereka mengeroyoknya, memukulinya sampai babak-belur Dalam keadaan parah, ia dibawa ke Al-Ramlah dan meninggal dunia di sana.

.

Ibnu Hajar di dalam Tandzib Al-Tandzib bercerita tentang Nashr bin Ali. Ia meriwayatkan hadis tentang keutamaan Hasan dan Husein: “Siapakah yang mencintai aku, mencintai keduanya, mencintai kedua orangtua mereka , ia bersamaku dalam derajat yang sama di hari kiamat.” Al-Mutawakkilmencambuknya 1.000 kali.

.

Ja’far bin Abdul-Wahid berulang kali mengingatkan Khalifah: “Hadza min Ahlis-Sunnah” (Dia ini dari Ahlus Sunnah). Barulah Khalifah menghentikan hukuman cambuknya.

.

Hari ini, umat Islam telah demikian maju dan terbuka, sehingga – saya (Jalaluddin Rakhmat) berharap – penulis pengantar, penerbit, dan pembaca buku ini tidak mengalami nasib, seperti Al-Nasa-i dan Nashr bin Ali.

.
Ketika Karen Armstrong menulis Muhammad: Prophet of Our Time, ia mengisi salah satu babnya dengan ayat-ayat setan. Karena ia pernah belajar sastra inggris, Armstrong menggunakan teknik-teknik cerita yang dramatis. Seorang muslim Indonesia yang tinggal di Amerika terkagum-kagum dengan tulisan Armstrong. Ia dipuji sebagai orang barat yang memberikan pengertian yang benar tentang Nabi Muhammad dan agama Islam. Ketika ia membaca terjemahannya dalam bahasa Indonesia, ia membaca kata pengantar dari KH. Jalaluddin Rakhmat yang biasa di panggil dengan Kang Jalal ini. “Saya baru tahu bahwa selama ini saya tidak bisa kritis membaca tarikh Nabi,” katanya dalam blognya di internet. Dalam pengantar buku itu Kang Jalal menulis:

“Para penguasa politik menciptakan naratif Nabi yang sesuai dengan kepentingan politiknya. Para pendusta yang tampak saleh mencemari naratif Nabi dengan imajinasinya. Dongeng-dongeng mereka masuk ke dalam perbendaharaan hadis. Hadis adalah berita tentang perkataan, perbuatan, ketetapan, dan sifat-sifat –fisik dan mental — yang dinisbahkan kepada Nabi SAW. Hadis adalah bahan utama tarikh Nabi. Bila sebagian sumber hadis adalah rekaan para penguasa dan para pendusta, apa yang terjadi pada tarikh Nabi?

Kita menemukan naratif Nabi yang tidak menggambarkan kesucian, kemuliaan, dan keagungan Nabi. Bayangkan biografi Anda ditulis oleh musuh-musuh Anda? Kisah-kisah Nabi seperti itu bertebaran pada kitab-kitab hadis dan tarikh. Kaum Munafik membacanya dengan senang. Peneliti non-Muslim berusaha memahaminya dengan latar belakang kebudayaannya.”

Jika kita tersinggung dengan naratif Salman Rushdie, kenapa kita tidak sakit hati dengan cerita-cerita Nabi yang melecehkan kemuliaannya; hanya karena kisah-kisah itu terdapat dalam kitab kuning atau disampaikan oleh ustaz-ustaz dan kiyai-kiyai yang soleh. Tentu saja tersinggung dengan mengadakan demonstrasi hanya akan mengantarkan penghina Islam dalam ketenaran global. Kisah itu akan terus diulangi. Alih-alih logika kekuatan, kita harus menggunakan kekuatan kekuatan logika. Buktikan bahwa kisah-kisah itu tidak bisa dinisbahkan kepada Manusia Pilihan, yang disapa Tuhan dengan indah: Innaka la’ala khuluqin azhim! Sesungguhnya engkau di atas akhlak yang agung.

Sebagaimana disebutkan dalam kata pengantar buku : Al-Mustafa edisi pertama (Buku yang ditulis oleh Kang Jalal), buku ini ditulis untuk mengembalikan kemuliaan dan kesucian Manusia Pilihan ke dalam cerita besar kita, Our grand narrative. Kaum mukmin yang sejati berusaha untuk menuliskan kisah hidupnya dengan pola kisah Nabi Saw. Celakalah dia, kalau kisah Nabi yang ditirunya, yang menjadi landasan misi hidupnya, adalah kisah yang keliru.

Al-Mushthafa (buku kritik historis sirah nabawiyah versi Jalaluddin Rakhmat)

Tarikh Rasulullah saw sangat penting bagi kaum muslim. Tarikh merupakan kumpulan hadis. Dari hadis, orang-orang yang saleh mengambil sunah yang dijadikan rujukan dalam kehidupan sehari-hari. Dengan merujuk kepada tarikh, kaum muslim menjalankan ibadahnya, mengembangkan akhlaknya, merencanakan perjuangannya, mengarahkan misi dan menetapkan tujuan hidupnya.

Rasulullah saw. adalah Al-Mushthafa, manusia pilihan yang disucikan. Dibandingkan dengan semua nabi dan pendiri agama lainnya, pencatatan kehidupan Nabi Muhammad saw. adalah yang paling lengkap dan paling terperinci.

Sayangnya, dalam perkembangan zaman, orang-orang yang tidak bertanggung jawab telah memasukkan hal-hal yang tidak pantas ada pada diri Rasulullah ke dalam hadis. Berita-berita dusta dinisbatkan kepada Rasulullah saw. Orang awam yang saleh menganggap berita dusta itu hadis dan mereka beragama berdasarkan hadis yang dipercayainya. Untungnya, sepanjang sejarah muncul para ulama yang mengkritisi hadis dan tarikh Rasulullah saw., kadang-kadang dengan risiko dianggap mengingkari sunah Rasul.

Jalaluddin Rakhmat melanjutkan upaya analisis kritis pada tarikh Rasulullah saw. dengan menggunakan metode historis berdasarkan aliran politik perawi hadis. Karena itu, buku ini akan sangat berguna bagi kaum muslim yang ingin menjalankan sunah Rasul yang sahih dan meyakinkan.

Buku AL-MUSHTHAFA ini diterbitkan salah satu penerbit Simbiosa. Terbit pada Mei 2008 dan tebalnya 300 halaman.

DAFTAR ISI:
Mengapa Perlu Studi Kritis?
Abduh: Penyebaran Dusta
Al-Madain: Dampak Kebijakan Muawiyah
Tarikh Nabi saw sebagai Dasar Agama
Kasykul KERANCUAN PENGERTIAN HADIS DAN SUNAH
Kerancuan Pengertian Hadis
Kerancuan Pengertian Sunah
Khatimah

Tarikh Nabi saw dalamTimbangan
Rasulullah adalah Uswatun Hasanah
Riwayat Wahyu Pertama
Pengujian Tarikh Nabi saw. dengan Al-Quran
Kritik Matan Hadis
Kontradiksi dalam Periwayatan Azan
Abu Bakar menjadi Imam salat pada hari-hari terakhir Rasulullah saw.
Metode Historis dalam Kkritik Hadis
Fungsi Analisis Historis.
Analisis Situasi Politik.
Analisis Aliran Politik Rijal

Masyarakat Jahiliah
Situasi Jazirah Arab Secara Geografis
Peranan Perempuan dan Kedudukannya di Zaman Jahiliah
Pengetahuan Arab Jahiliah
Keistimewaan Akhlak Arab Jahiliah

Seputar Masa Muda Al-Mushthafa
Kehidupan Rasulullah saw.
Kisah Bahirah
HARBU AL-FUJJAR (perang orang-orang durhaka)
HILFU AL-FUDHUL (Sumpah Setia)
Pernikahan Dengan Khadijah

Menjelang Bi`tsah
Peristiwa Membangun Kakkbah
Nabi saw. Sangat Pemalu dan Sangat Rendah Hati

10 Versi Turunnya Wahyu yang Pertama Kepada Rasulullah
Siapa sebenarnya Waraqah bin Naufal, Addas, Bahirah dan Nusthur?
Apa yang sahih dalam permulaan wahyu ini?
Jenis-Jenis Wahyu Menurut Al-Quran
Bagaimana datangnya wahyu kepada Rasulullah?

 

artikel2 seperti ini akan menyadarkan kebenaran yang semestinya diketahui orang2 yang berhikmat terhadap agamanya.

 

Literatur Ahlusunnah terkait Dengan Penyerangan ke Rumah Fatimah As

Terkait dengan hal ini kami akan mengutip beberapa matan dari kitab-kitab Ahlusunnah sehingga menjadi jelas bahwa masalah penyerangan kediaman Hadhrat  Fatimah Zahra Sa merupakan sebuah peristiwa sejarah faktual dan niscaya serta bukan sebuah mitos dan legenda!!

.

Meski pada masa para khalifah terjadi sensor besar-besaran terhadap penulisan keutamaan dan derajat (para maksum); akan tetapi kaidah menyatakan bahwa “hakikat (kebenaran) adalah penjaga sesuatu.” Hakikat sejarah ini tetap hidup dan terjaga dalam kitab-kitab sejarah dan hadis. Di sini kami akan mengutip beberapa referensi dengan memperhatikan urutan masa semenjak abad-abad pertama hingga masa kiwari.

1. Ibnu Abi Syaibah dan kitab “Al-Mushannaf:  Abu Bakar bin Abi Syaibah (159-235 H) pengarang kitab al-Mushannaf dengan sanad sahih menukil demikian:  “Tatkala orang-orang memberikan baiat kepada Abu Bakar, Ali dan Zubair berada di rumah Fatimah berbincang-bincang dan melakukan musyawarah. Hal ini terdengar oleh Umar bin Khattab. Ia pergi ke rumah Fatimah dan berkata, “Wahai putri Rasulullah, ayahmu merupakan orang yang paling terkasih bagi kami dan setelah Rasulullah adalah engkau. Namun demi Allah! Kecintaan ini tidak akan menjadi penghalang.  Apabila orang-orang berkumpul di rumahmu maka Aku akan perintahkan supaya rumahmu dibakar. Umar bin Khattab menyampaikan ucapan ini dan keluar. Tatkala Ali As dan Zubair kembali ke rumah, putri Rasulullah Saw menyampaikan hal ini kepada Ali As dan Zubair: Umar datang kepadaku dan bersumpah apabila kalian kembali berkumpul maka ia akan membakar rumah ini. Demi Allah! Apa yang ia sumpahkan akan dilakukannya!

2. Baladzuri dan kitab “Ansab al-Asyrâf: Ahmad bin Yahya Jabir Baghdadi Baladzuri (wafat 270) penulis masyhur dan sejarawan terkemuka, mengutip peristiwa sejarah ini dalam kitab “Ansab al-Asyrâf” sebagaimaan yang telah disebutkan.  Abu Bakar mencari Ali As untuk mengambil baiat darinya, namun Ali tidak memberikan baiat kepadanya. Kemudian Umar bergerak disertai dengan alat untuk membakar dan kemudian bertemu dengan Fatima di depan rumah. Fatimah berkata, “Wahai putra Khattab! Saya melihat kau ingin membakar rumahku? Umar berkata, “Iya. Perbuatan ini akan membantu pekerjaan yang untuknya ayahmu diutus.”

SERANGAN KE RUMAH FATHIMAH..

Kekhalifahan Abu Bakar merupakan ijma ulama yang wajib diterima bagi setiap Muslim. Pertama-tama perlu dijelaskan bahwa kita percaya ijma bersifat mengikat. oleh sebab itu Ahlu Sunnah wal Jam’ah menentukan WAJIB mengikuti ijma’ apapun konsekuensinya hingga penentangan Thd kekhalifahan hasil ijma’ HARUS diterima bahkan jika diperlukan bisa dipaksakan diterima .

Tidak semua sahabat sepakat bahwa keempat khalifah ini adalah pengganti Nabi Muhammad yang sah. Kaum Muslimin sepakat bahwa kekhalifahan Abu Bakar dipilih oleh sejumlah orang yang terbatas dan merupakan hal yang mengejutkan bagi sahabat lainnya. Oleh sejumlah orang terbatas artinya mayoritas sahabat Nabi Muhammad yang utama tidak mengetahui pemilihan ini. Ali, Ibnu Abbas, Utsman, Thalhah, Zubair, Sa’d bin Abi Waqqash, Salman Farisi, Abu Dzar, Ammar bin Yasir, Miqdad, Abdurrahman bin Auf adalah di antara sahabat-sahabat yang tidak diajak berunding bahkan diberitahu. Bahkan Umar sendiri mengakui, pemilihan Abu Bakar dilakukan tanpa perundingan dengan kaum Muslimin.( l )

Kita tidak dapat menutup mata pada kenyataan yang tidak dapat disangkal yang bahkan dicatat oleh ulama-ulama Sunni dan meskipun telah menjadi ijma. Setelah Nabi Muhammad wafat, orang-orang yang melaksanakan apa yang diperintahkan Nabi Muhammad seperti Ammar bin Yasir, Abu Dzar Ghiffari, Miqdad, Salman Farisi, Ibnu Abbas, dan sahabat-sahabat lain seperti Abbas, Utbah bin Abi Lahab, Bara bin Azib, Ubay bin Ka’b, Sa’d bin Abi Waqqash, dan lain-lain berkumpul di rumah Fathimah.

Demikian juga dengan Thalhah dan Zubair yang awalnya setia kepada Ali dan bergabung dengan yang lainnya di rumah Fathimah. Mereka berkumpul di rumah Fathimah sebagai tempat berlindung karena mereka menentang mayoritas orang-orang. Berdasarkan hadis Shahih Bukhari, Umar mengakui bahwa Ali dan pengikutnya menentang Abu Bakar.

Bukhari meriwayatkan bahwa Umar berkata,

“Tidak diragukan lagi setelah Rasul wafat, kami diberi tahu bahwa kaum Anshar tidak sepakat dengan kami dan berkumpul di balairung Bani Saidah. Ali dan Zubair dan orang – orang yang bersama mereka menentang kami.”(2)

Hadis lain meriwayatkan bahwa Umar berkata pada hari Saqifah,

“Ali bin Abi Thalib, Zubair bin Awwam dan orang-orang yang bersama mereka berpisah dari kami dan berkumpul di rumah Fathimah, putri Nabi Muhammad.”(3)

Selain itu, mereka meminta persetujuan baiat tersebut, tetapi Ali dan Zubair meninggalkannya. Zubair menghunuskan pedang dan berkata, “Aku tidak akan menyarungkan pedang ini sebelum sumpah setia diberikan kepada Ali.” Ketika kabar ini sampai kepada Abu Bakar dan Umar, Umar berkata, “Lempar ia dengan batu dan rampas pedangnya!” Diriwayatkan bahwa Umar bergegas (menuju ke depan pintu Fathimah) dan menggiring mereka dengan paksa sambil mengatakan bahwa mereka harus memberikan sumpah setia secara sukarela ataupun paksa.(4)

Pemilihan seperti apakah itu? Pemilihan menyiratkan suatu pilihan dan kebebasan, dan setiap kaum Muslimin berhak memilih wakilnya. Barang-siapa yang memilihnya tidak menentang Allah atau Rasulnya karena baik Allah atau Rasulnya tidak menunjuk orang dari pilihan umat. Pemilihan, secara fitrah, tidak memaksa setiap kaum Muslimin untuk memilih wakil khususnya. Apabila tidak, pemilihan tersebut berarti paksaan. Artinya pemilihan itu akan kehilangan fitrahnya dan menjadi tindakan pemaksaan. Ucapan Nabi yang terkenal menyatakan, “Tidak ada sumpah setia yang sah jika diperoleh dengan paksaan.”

Mari kita lihat apa yang dilakukan Umar pada saat itu.

Sejarahwan Sunni meriwayatkan bahwa ketika Umar sampai di depan pintu rumah Fathimah, ia berkata,

“Demi ,Allah, aku akan membakar (rumah ini) jika kalian tidak keluar dan berbaiat kepada (Abu Bakar)!”(5)

Selain itu, Umar bin Khattab datang ke rumah Ali. Talhah dan Zubair serta beberapa kaum Muhajirin lain juga berada di rumah itu.

Umar berteriak,

“Demi Allah, keluarlah kalian dan baiat Abu Bakar jika tidak akan kubakar rumah ini.” Zubair keluar dengan pedang terhunus, karena ia terjatuh (kakinya tersandung sesuatu), pedangnya lepas dari tangannya, merekapun menerkamnya dan membekuknya.(6)

Abu Bakar, berdasarkan sumber riwayat yang shahih, berkata bahwa ketika umat telah berbaiat padanya setelah Nabi Muhammad wafat, Ali dan Zubair sering pergi ke Fathimah Zahra, putri Nabi Muhammad, untuk bertanya.

Ketika berita ini diketahui Umar, ia pergi ke rumah Fathimah dan berkata,

“Wahai putri Rasulullah! Aku tidak mencintai seorang pun sebanyak cintaku pada ayahmu, dan tidak ada seorang pun setelahnya yang lebih aku cintai selain engkau. Tetapi, Demi Allah, sekiranya orang-orang ini berkumpul bersamamu, kecintaan ini tidak akan mencegahku untuk membakar rumahmu.”(7)

Diriwayatkan pula bahwa Umar berkata kepada Fathimah (yang berada di belakang pintu),

“Aku mengetahui bahwa Rasulullah tidak mencintai siapa pun lebih dari cintanya padamu. Tetapi kehendakku tidak akan menghentikanku melaksanakan keputusanku. Jika orang-orang ini berada di rumahmu, aku akan membakar pintu ini di hadapanmu.”(8)

Sebenarnya Syilbi Numani sendiri menyaksikan peristiwa di atas dengan kata-kata berikut:

“Dengan sifat Umar yang pemarah, perbuatan tersebut sangat tidak mungkin dilakukan.”9

Diriwayatkan pula bahwa Abu Bakar berkata menjelang kematiannya,

“Andai saja aku tidakpergi ke rumah Fathimah dan mengirim orang-orang untuk menyakitinya, meskipun hal itu akan menimbulkan peperangan jika rumah tersebut tetap digunakan sebagai tempat berlindung.”(10)

Sejarahwan menyebutkan nama-nama berikut adalah orang-¬orang yang menyerang rumah Fathimah untuk membakar orang-orang yang berlindung di dalamnya; Umar bin Khatab, Khalid bin Walid, Abdurrahman bin Auf, Tsabit bin Shammas, Ziyad bin Labid, Muhammad bin Maslamah, Salamah bin Salim bin Waqqash, Salamah bin Aslam, Usaid bin Huzair, Zaid bin Tsabit.

Ulama Sunni yang ditakzimkan, Abu Muhammad bin Muslim bin Qutaibah Dainuri dalam kitab al-Imamah wa as-Siyasah meriwayatkan bahwa Umar meminta sebatang kayu dan berkata kepada orang orang yang berada di dalam rumah, “Aku bersumpah demi Allah yang menggenggam jiwaku, jika kalian tidak keluar, akan aku bakar rumah ini!” Seseorang memberitahu Umar bahwa Fathimah berada di dalam. Umar berteriak, “Sekalipun! Aku tidak peduli siapa pun yang berada di dalam rumah itu.”(11)

Baladzuri, seorang sejarahwan lain meriwayatkan bahwa Abu Bakar meminta Ali untuk memberi dukungan kepadanya tetapi Ali menolak. Kemudian Umar berjalan ke rumah Ali sambil membawa kayu bakar di tangannya. Ia bertemu Fathimah di muka pintu. Fathimah berkata, “Engkau berniat membakar pintu rumahku?” Umar menjawab, “Ya, karena hal ini akan menguatkan agama yang diberikan kepada kami dari ayahmu.”(12)

Dalam kitabnya, Jauhari berkata bahwa Umar dan beberapa kaum Muslimin pergi ke rumah Fathimah untuk membakar rumahnya dan orang-orang di dalamnya yang menentang. Ibnu Shahna menambahkan, “Membakar rumah serta penghuninya.”

Lebih jauh lagi diriwayatkan bahwa ketika Ali dan Abbas sedang duduk di dalam rumah Fathimah, Abu Bakar berkata kepada Umar, “Pergi dan bawalah mereka, jika mereka menentang, bunuh mereka!” Umar membawa sepotong kayu bakar untuk membakar rumah tersebut. Fathimah keluar dari pintu dan berkata, “Hai putra Khattab, apakah kamu datang untuk membakar rumah yang di dalamnya terdapat aku dan anak¬-anakku?” Umar menjawab, “Ya, demi Allah, hingga mereka keluar berbaiat kepada khalifah Rasul.”(13)

Semua orang keluar dari rumah kecuali Ali. Ia berkata, “Aku bersumpah akan tetap berada di rumahku sampai aku selesai mengumpulkan Quran.”

Umar tidak terima tetapi Fathimah membatahnya hingga ia berbalik. Umar menghasut Abu Bakar untuk menyelesaikan masalah tersebut. Abu Bakar kemudian mengirim Qunfiz (budaknya) tetapi selalu menerima jawaban negatif setiap kali ia menemui Ali. Akhirnya, Umar pergi dengan sekelompok orang ke rumah Fathimah.

Ketika Fathimah mendengar suara mereka, ia berteriak keras,

“Duhai ayahku, Rasulullah! Lihatlah bagaimana Umar bin Khattab dan Abu Bakar memperlakukan kami setelah engkau tiada! Lihatlah bagaimana cara mereka menemui kami!”

Ulama-ulama Sunni seperti Ahmad bin Abdul Aziz Jauhari dalam bukunya Saqifah, Abu Wahid Muhibuddin Muhammad Syahnah Hanafi dalam bukunya Syarh al-Nahj, dan lainnya telah meriwayatkan peristiwa yang sama.

Lihat juga sejarahwan terkemuka Sunni, Abdul Hasan, Ali bin Husain Mas’udi dalam bukunya Ishabat al-Wasiyyah, menjelaskan peristiwa tersebut secara terperinci dan meriwayatkan, “Mereka mengelilingi Ali dan membakar pintu rumahnya, melemparkannya serta mendorong penghulu seluruh perempuan (Fathimah) ke dinding yang menyebabkan terbunuhnya Muhsin (putra berusia 6 bulan yang tengah dikandungnya).

Shalahuddin Khalil Safadi, ulama Sunni lain, dalam kitabnya Wafi al-Wafiyyat, pada surat ‘A’ ketika mencatat pandangan/pendapat Ibrahim bin Sayar bin Hani Basri, yang terkenal dengan nama Nidzam mengutip bahwa ia berkata,

“Pada hari pembaiatan, Umar memukul perut Fathimah sehingga bayi dalam kandungannya meningggal.”

Menurut anda mengapa perempuan muda berusia 18 tahun harus terpaksa berjalan ditopang tongkat? Kekerasan serta tekanan yang sangat hebat menyebabkan Sayidah Fathimah Zahra senantiasa menangis, “Bencana itu telah menimpaku sehingga sekiranya bencana itu datang di siang hari, hari akan menjadi gelap.” Sejak itu Fathimah jatuh sakit hingga wafatnya akibat bencana dan sakit yang menimpanya, padahal usianya baru 18 tahun.

Seperti yang dikutip oleh Ibnu Qutaibah menjelang hari–hari terakhirnya, Fathimah selalu memalingkan wajahnya ke dinding, ketika Umar dan Abu Bakar datang membesuknya menjawab ucapan mereka yang mendoakan kesembuhannya, Fathimah mengingatkan Umar dan Abu Bakar tentang pernyataan Nabi Muhammad bahwa barang siapa yang membuat Fathimah murka, maka ia telah membuat murka Nabi.

Fathimah berkata,

“Allah dan malaikat menjadi saksiku bahwa engkau membuatku tidak ridha, dan kalian telah membuatku murka. Apabila aku ber¬temu ayahku, akan kuadukan semua perbuatan kalian berdua!”(14)

Karena alasan yang sama, Fathimah ingin agar kedua orang yang telah menyakitinya jangan sampai hadir di pemakamannya dan oleh karenanya ia dimakamkan malam hari. Bukhari, dalam kitabnya menegaskan bahwa Ali menuruti keinginan istrinya. Bukhari meriwayatkan dari Aisyah bahwa Fathimah sangat marah kepada Abu Bakar sehingga ia menjauhinya, tidak berbicara dengannya sampai wafatnya. Fathimah hidup selama 6 bulan setelah Nabi Muhammad wafat. Ketika Fathimah wafat, suaminya Ali menguburkannya di malam hari tanpa memberitahukan Abu Bakar dan melakukan shalat jenazah sendiri.(l5 )

Usaha apa pun yang mereka lakukan, mereka tidak dapat menemukan makamnya. Makam Fathimah hanya diketahui oleh keluarga Ali. Hingga saat ini makam putri Nabi Muhammad yang tersembunyi merupakan tanda-tanda ketidaksukaannya kepada beberapa sahabat.

Pendapat Nabi Muhammad terhadap Orang-orang yang Menyakiti Fathimah

Nabi Muhammad sudah berulang kali mengatakan,

“Fathimah adalah bagian dari diriku. Barangsiapa membuatnya murka, ia telah membuatku murka!”(16)

PENUTUP…:

ORANG GILA MANA YANG BERANI MAIN2 DENGAN MURKANYA NABI SAWW TAPI NGGA PUNYA MALU NGAKU CINTA NABI ?

Catatan Kaki :

1. Lihat Shahih Bukhari, versi Arab-Inggris, jilid 8, hadis 8.17.

2. Referensi hadis Sunni: Bukhari, Arab-Inggris, vol. 8, hadis 8.17.

3. Referensi hadis Sunni: Musnad Ahmad ibn Hanbal, jilid 1, hal. 55; Sirah aai-Nabawiyyah oleh Ibnu Hisyam, jilid 4, ha1.309; Tarikh ath-Thabari, jilid 1, hal. 1822; Tarikh ath-Thabari, versi bahasa Inggris, jilid 9, hal. 192.

4. Referensi hadis Sunni: Tarikh ath-Thabari, versi bahasa Inggris, jilid 9, ha1.188-189.

5. Referensi hadis Sunni: Tarikh ath-Thabari (bahasa Arab), jilid 1, hal. 1118-1120; Tarikh, Ibnu Atsir, jilid 2, hal. 325; al-Isti’ab oleh Ibnu Abdil Barr, jilid 3, hal. 975; Tarikh al-Khulafa oleh Ibnu Qutaibah, jilid 1, hal. 20; al-Imamah wa as-Siyasah oleh Qutaibah, jilid 1, ha1.19-20.

6. Referensi hadis: Tarikh ath-Thabari, versi bahasa Inggris, jilid 9, ha1.186¬187. Pada catatan kaki di halaman yang sama (ha1.187) penerjemahnya memberi komentar, “Meskipun waktunya tidak jelas, nampaknya Ali dan kelompoknya mengetahui tentang peristiwa di Saqifah setelah apa yang terjadi di sana. Para pendukungnya berkumpul di rumah Fathimah. Abu Bakar dan Umar sangat menyadari tuntutan Ali. Karena takut ancaman serius dari pendukung Ali, Umar mengajaknya ke masjid untuk memberi sumpah setia. Ali menolak, sehingga rumah tersebut dikelilingi oleh pasukan pimpinan Abu Bakar-Umar, yang mengancam akan membakar rumah sekiranya Ali dan pengikutnya tidak keluar dan memberi sumpah setia kepaLta Abu Bakar. Keadaan bertambah panas dan Fathimah marah. Lihat Ansab Asyraf oleh Baladzuri dalam kitabnya jilid 1, ha1.582-586; Tarikh Ya’qubi, jilid 1, ha1.116, al-Imamah wn as-Siyasah oleh Ibnu Qutaibah, jilid 1, hal. 19-20.

7. Referensi hadis Sunni: Tarikh ath-Thabari, pada peristiwa tahun 11 H; al-Imamah wa as-Siyasah oleh Ibnu Qutaibah, jilid 1, pengantar isi, dan ha1.19-20; Izalat al-Khalifah oleh Syah Wahuilah Muhaddis Dehlavi, jilid 2, hal. 362; Iqd al-Farid oleh Ibnu Abdurrabbah Malik, jilid 2, bab Saqifah.

8. Referensi hadis Sunni: Kanz al-Ummal, jilid 3, hal. 140.

9. Referensi hadis Sunni: al-Faruq oleh Syibli Numani, hal. 44.

10. Referensi hadis Sunni: Tarikh al-Ya’qubi, jilid 2, ha1.115-116; Asab Asyraf oleh Baladzuri, jilid 1, hal. 582, 586.

11. Referensi hadis Sunni: al-Imamah wa as-Siyasah oleh Ibnu Qutaibah, jilid 1, hal. 3, 19-20.

12. Referensi hadis Sunni: al-Ansab Asyraf oleh Baladzuri, jilid 1, ha1.582, 586.

13. Referensi hadis Sunni: Iqd al-Farid oleh Ibnu Abdurrabbah, bagian 3, ha1.63; al-Ghurar oleh Ibnu Khazaben, bersumber dari Zaid Ibnu Aslam.

14. Al-Imamah wa as-Siyasah oleh Ibnu Qutaibah, jilid 1, hal.4.

15. Referensi hadis Sunni: Shahih Bukhari, bab Perang Khaibar, Arab ¬Inggris jilid 5; Tarikh Thabari, jilid IX, ha1.196 (peristiwa tahun 11, versi bahasa

Tidak ada kontradiksi antara Syi’ah dengan Sahabat Yang Dipuji AL Quran


Anas bin Malik meriwayatkan bahwa Rasulullah SAW
 bahwa beliau SAWW pernah bersabda kepada kaum Anshar: “Suatu hari kalian akan menyaksikan sifat tamak yang dahsyat sepeninggalku. Karena itu bersabarlah sehingga kalian menemui Allah dan Rasul-Nya di telaga haudh.” Anas berkata, “Kami tidak sabar.“(1)

Ala’ bin Musayyab dari ayahnya pernah berkata: “Aku berjumpa dengan Barra’ bin A’zib ra. Kukatakan padanya, “berbahagialah Anda karena dapat bersahabat dengan Nabi SAWW dan membai’atnya di bawah pohon (bai’ah tahta syajarah). Barra’ menjawab, “wahai putera saudaraku, engkau tidak tahu apa yang telah kami lakukan sepeninggalnya.”(2)

Jika sahabat utama yang tergolong di antara as-Sabiqin al-Awwalin dan pernah membai’at Nabi di bawah pohon, serta Allah rela kepada mereka dan Maha Tahu apa yang ada dalam hati mereka sehingga diberinya ganjaran yang besar;  apakah mereka yang menghianati Bai’ah itu tetap diridhoi Allah ? apalagi  sahabat-sahabat ini kemudian bersaksi bahwa dirinya dan para sahabat yang lain telah melakukan “sesuatu yang berbeda (baca bid’ah)” sepeninggal  Nabi, pengakuan mereka ini adalah bukti kebenaran yang disabdakan oleh Nabi SAW bahwa sebagian dari sahabatnya akan berpaling darinya sepeninggalnya.

Rasululah SAW juga  telah bersabda: “Siapa yang mencaci Ali maka dia telah mencaciku; dan siapa yang mencaciku maka dia telah mencaci Allah; dan siapa yang mencaci Allah maka Allah akan menjatuhkannya ke dalam api neraka.“(3)

Sangat jelas hukuman bagi orang yang mencaci Imam Ali AS.  Lalu apa hukuman bagi mereka yang melaknatnya dan memeranginya., sementara sejarah mengabarkan bahwa Muawiyah melaknati Imam Ali AS selama 70 tahun lebih , dan juga beliau AS telah diperangi oleh 3 kelompok dalam 3 Perang Besar.

1. Shahih Bukhari jil. 2 hal. 135

2. Shahih Bukhari jil.3 hal. 32.

3. Mustadrak al-Hakim jil. 3 hal. 121; Khasais an-Nasai hal. 24; Musnad Ahmad Bin Hanbal jil. 6 hal. 33; Manaqib al-Khawarizmi

Syi’ah Mencela Sahabat Nabi ?? Syi’ah Hina Sahabat Nabi ?? Syi’ah Mencaci Sahabat Nabi ?? Syi’ah mengkafirkan para Sahabat ??

(1) ADA YANG MENINGGALKAN NABI KETIKA SEDANG KHOTBAH JUM’AT, HANYA UNTUK MELIHAT PERNIAGAAN DAN PERMAINAN

Dan apabila mereka melihat perniagaan atau permainan, mereka bubar untuk menuju kepadanya dan mereka tinggalkan kamu sedang berdiri (berkhotbah). Katakanlah: “Apa yang di sisi Allah lebih baik daripada permainan dan perniagaan”, dan Allah Sebaik-baik Pemberi rezeki. (Al Jumuah : 11)

(2) ADA YANG MENYAKITI NABIT DENGAN MEMBUAT GOSIP MURAHAN

Di antara mereka  ada yang menyakiti Nabi dan mengatakan: “Nabi mempercayai semua apa yang didengarnya”. Katakanlah: “Ia mempercayai semua yang baik bagi kamu, ia beriman kepada Allah, mempercayai orang-orang mukmin, dan menjadi rahmat bagi orang-orang yang beriman di antara kamu”. Dan orang-orang yang menyakiti Rasulullah itu, bagi mereka azab yang pedih. (At Taubah : 61)

(3) ADA YANG BERSUMPAH PALSU

Mereka bersumpah dengan (nama) Allah, bahwa mereka tidak mengatakan (sesuatu yang menyakitimu). Sesungguhnya mereka telah mengucapkan perkataan kekafiran, dan telah menjadi kafir sesudah Islam dan mengingini apa yang mereka tidak dapat mencapainya, dan mereka tidak mencela (Allah dan Rasul-Nya), kecuali karena Allah dan Rasul-Nya telah melimpahkan karunia-Nya kepada mereka. Maka jika mereka bertaubat, itu adalah lebih baik bagi mereka, dan jika mereka berpaling, niscaya Allah akan mengazab mereka dengan azab yang pedih di dunia dan akhirat; dan mereka sekali-kali tidaklah mempunyai pelindung dan tidak (pula) penolong di muka bumi. (At Taubah : 74)

(4) ADA YANG KIKIR DAN ENGGANG BERSEDEKAH

Dan diantara mereka ada orang yang telah berikrar kepada Allah: “Sesungguhnya jika Allah memberikan sebahagian karunia-Nya kepada kami, pastilah kami akan bersedekah dan pastilah kami termasuk orang-orang yang saleh. Maka setelah Allah memberikan kepada mereka sebahagian dari karunia-Nya, mereka kikir dengan karunia itu, dan berpaling, dan mereka memanglah orang-orang yang selalu membelakangi (kebenaran).(At Taubah : 75-76)

(5) ADA YANG MENINGGIKAN SUARA DIHADAPAN NABI DAN BERKATA DENGAN SUARA KASAR (KERAS)

Hai orang-orang yang beriman, janganlah kamu meninggikan suaramu melebihi suara Nabi, dan janganlah kamu berkata kepadanya dengan suara yang keras, sebagaimana kerasnya suara sebagian kamu terhadap sebagian yang lain, supaya tidak hapus (pahala) amalanmu, sedangkan kamu tidak menyadari. (Al Hujuraat : 2)

(6) ADA YANG MENCAMPUR ADUKKAN KEBAIKAN DAN KEBURUKAN

“Dan ada pula yang lain, yang mengakui dosa-dosa mereka, mereka mencampuradukkan pekerjaan yang baik dengan pekerjaan lain yang buruk. Mudah-mudahan Allah menerima tobat mereka. Sesungguhnya Allah Maha pengampun lagi Maha Penyayang.” (Qs. At-Taubah: 102).

(7) ADA YANG BERPRASANGKA SEPERTI PRASANGKA JAHILIYA KEPADA ALLAH – KETIKA RASULULLAH MENYERUKAN UNTUK BERPERANG

Kemudian setelah kamu berdukacita, Allah menurunkan kepada kamu keamanan (berupa) kantuk yang meliputi segolongan dari pada kamu, sedang segolongan lagi telah dicemaskan oleh diri mereka sendiri, mereka menyangka yang tidak benar terhadap Allah seperti sangkaan jahiliyah. Mereka berkata: “Apakah ada bagi kita barang sesuatu (hak campur tangan) dalam urusan ini?”. Katakanlah: “Sesungguhnya urusan itu seluruhnya di tangan Allah”. Mereka menyembunyikan dalam hati mereka apa yang tidak mereka terangkan kepadamu; mereka berkata: “Sekiranya ada bagi kita barang sesuatu (hak campur tangan) dalam urusan ini, niscaya kita tidak akan dibunuh (dikalahkan) di sini”. Katakanlah: “Sekiranya kamu berada di rumahmu, niscaya orang-orang yang telah ditakdirkan akan mati terbunuh itu keluar (juga) ke tempat mereka terbunuh”. Dan Allah (berbuat demikian) untuk menguji apa yang ada dalam dadamu dan untuk membersihkan apa yang ada dalam hatimu. Allah Maha Mengetahui isi hati.(Ali Imran : 154)

(8) ADA YANG MENGANGGAP JANJI ALLAH DAN RASULULLAH SEBAGAI TIPU DAYA

“Dan (ingatlah) ketika orang- orang munafik DAN orang-orang yang berpenyakit dalam hatinyaberkata:” Allah dan Rasul-Nya tidak menjanjikan kepada kami melainkan tipu daya.” (QS. Al Ahzâb ;12)

(9) ADA YANG ENGGAN UNTUK IKUT DALAM BERPERANG

“Wahai orang-orang yang beriman! Bersiap siagalah kamu dan majulah (ke medan pertempuran) secara berkelompok atau majulah bersama-sama (serentak). Dan sesungguhnya di antara kamu pasti ada orang yang sangat enggan (ke medan pertempuran). Lalu jika kamu ditimpa musibah dia berkata, “Sungguh, Allah telah memberikan nikmat kepadaku, karena aku tidak ikut berperang bersama mereka.” (Qs. An-Nisa’: 71-72).

(10) JIKA MEREKA IKUT PERANG, MALAH MEMBUAT KEKACAUAN DAN MELEMAHKAN”

Jika (mereka berangkat bersamamu), niscaya mereka tidak akan menambah (kekuatan)mu, malah hanya akan membuat kekacauan, dan mereka tentu bergegas maju kedepan di celah-celah barisanmu untuk mengadakan kekacauan (dibarisanmu); sedang diantara kamu ada orang-orang yang sangat suka mendengarkan (perkataan) mereka. Allah mengetahui orang-orang yang dzalim.”(Qs. At-Taubah: 47).

(11) LARI DARI MEDAN PERANG

Sesungguhnya Allah telah menolong kamu (hai para mukminin) di medan peperangan yang banyak, dan (ingatlah) peperangan Hunain, yaitu diwaktu kamu menjadi congkak karena banyaknya jumlah(mu), maka jumlah yang banyak itu tidak memberi manfaat kepadamu sedikitpun, dan bumi yang luas itu telah terasa sempit olehmu, kemudian kamu lari kebelakang dengan bercerai-berai.(At Taubah : 25)

(12) TIDAK MEMATUHI PERINTAH NABI, HANYA DEMI BEREBUT RAMPASAN PERANG

(Ingatlah) ketika kamu lari dan tidak menoleh kepada seseorangpun, sedang Rasul yang berada di antara kawan-kawanmu yang lain memanggil kamu, karena itu Allah menimpakan atas kamu kesedihan atas kesedihan, supaya kamu jangan bersedih hati terhadap apa yang luput dari pada kamu dan terhadap apa yang menimpa kamu. Allah Maha Mengetahui apa yang kamu kerjakan. (Ali Imran : 153)

AKHIRNYA ALLAH TELAH MERUBAH HATI MEREKA DAN MENJADIKAN MEREKA SEBAGAI ORANG MUNAFIK KARENA KALAKUAN DAN PERBUATAN MEREKA YANG SEPERTI DIATAS

Maka Allah menimbulkan kemunafikan pada hati mereka sampai kepada waktu mereka menemui Allah, karena mereka telah memungkiri terhadap Allah apa yang telah mereka ikrarkan kepada-Nya dan juga karena mereka selalu berdusta. (At Taubah : 77)

SEHINGGA KARENANYA ALLAH MENGATAKAN BAHWA BANYAK ORANG MUNAFIK DISEKITAR RASULULLAH“Dan diantara orang-orang Arab yang (tinggal) di sekitarmu, ada orang-orang munafik. Dan di antara penduduk Madinah (ada juga orang-orang munafik), mereka keterlaluan dalam kemunafikannya. Engkau (Muhammad) tidak mengetahui mereka, tetapi Kami mengetahuinya. Nanti mereka akan Kami siksa dua kali, kemudian mereka akan dikembalikan kepada azab yang besar.” (Qs. At-Taubah: 101).

12 imam maksum merupakan penjelas Al Quran, maka orang biasa hanya bisa membaca Al Qur`an secara literal saja. Sesuai huruf dan kata-kata yang tercetak. Sedangkan untuk mengetahui maksudnya yang sebenarnya, ia harus merujuk para imam Ahlul Bait.

فإنما على الناس أن يقرؤوا القرآن كما أنزل ، فإذا احتاجوا إلى تفسيره فالاهتداء بنا وإلينا. (وسائل الشيعة، الحر العاملي، 27/202).

“Orang boleh saja membaca Al Qur`an sebagaimana ia diturunkan. Tapi ketika ia memerlukan penafsirannya, maka mereka harus berpedoman pada kami dan merujuk kami.” (Wasa`il asy Syi’ah, oleh al Hurr al ‘Amili, 27/202).

Seperti itu juga ketika Allah SWT memberi ancaman bagi kemungkinan ada orang yang ingin mempermainkan ayat-ayat Al Qur`an. Di sana dikatakan:

“Ia adalah wahyu yang diturunkan dari Tuhan semesta alam. Seandainya dia (Muhammad) mengadakan sebagian perkataan atas (nama) Kami, niscaya benar-benar Kami pegang dia pada tangan kanannya. Kemudian benar-benar Kami potong urat tali jantungnya. Maka sekali-kali tidak ada seorangpun dari kamu yang dapat menghalangi (Kami), dari pemotongan urat nadi itu. Dan sesungguhnya Al-Qur`an itu benar-benar suatu pelajaran bagi orang-orang yang bertakwa. Dan sesungguhnya Kami benar-benar mengetahui bahwa di antara kamu ada orang yang mendustakan(nya). Dan sesungguhnya Al-Qur`an itu benar-benar menjadi penyesalan bagi orang-orang kafir (di akhirat). Dan sesungguhnya Al-Qur`an itu benar-benar kebenaran yang diyakini. Maka bertasbihlah dengan (menyebut) nama Tuhanmu Yang Maha Besar.” (Qs. Al-Haaqqah 69: 43-52).

Dari penjelasan ayat-ayat tersebut, jelaslah orang yang bermain-main dengan ayat-Nya akan segera mendapatkan adzab dari Allah SWT

Apakah para sahabat Nabi bisa dijadikan hujjah dan teladan dalam beragama?

Syi’ah hanya menerima sebagian hadis sunni , ini membuktikan Syi’ah menghormati para sahabat …

Syi’ah menghormati sahabat sahabat YANG SALEH SALEH saja..

“… banyak bukti bahwa sahabat ternyata pernah ragu dalam agamanya .. pernah menentang dan membangkang perintah Rasulullah SAW… pernah meninggalkan ibadat dan sebagainya…”Oleh karenanya, menurut Dr. Jalaluddin Rakhmat, kita harus memilih sahabat yang betul-betul telah lolos uji, dan tidak pernah salah atau menolak perintah Nabi SAW…Dia berkata, “Untuk Anda ketahui, ada lebih dari 114 ribu sahabat Nabi SAW. Di antara mereka ada yang –berdasarkan bukti-bukti- memenuhi karakteristik yang disebutkan oleh Al-Razi. Pilihlah sahabat yang lolos dari batu uji al-Razi. Sahabat yang betul-betul adil.Dari mana kita tahu? Melalui kajian ilmiah yang tekun bersama orang-orang, yang demi kebenaran “la yakhâfûna lawmatan lâim” (Qs. Al-Quran 5:54), “tidak takut pada kecaman orang-orang yang mengecam
.
Siapakah orang yang dia maksud itu?
Dr. Jalaluddin Rakhmat memberi indikasi bahwa: dia adalah Ali bin Abi Thalib dan syi’ahnya. Dengan berdasarkan hadits Ibn Asakir dari Jabir bin Abdillah. Ia berkata: “Kami sedang bersama Nabi SAW, lalu datanglah Ali. Nabi SAW berkata: Demi yang diriku ada di tangannya. Sesungguhnya ini dan Syi’ahnya sungguh orang-orang yang berbahagia pada hari kiamat.” Dia juga menyebut riwayat Ibn Adi dan Ibn Asakir dari Ibn Abbas, dan riwayat Ibn Mardawayh dari Ali r.a.Dan ketika kita cermati ajakannya ini: “Pilihlah sahabat yang lolos dari batu uji .. Sahabat yang betul-betul adil.”

Muhammad al Baqir, imam yang kelima menyatakan :

عن سلام بن المستنير قال: كنت عند أبي جعفر، فدخل عليه حمران بن أعين، فسأله عن أشياء، فلما هم حمران بالقيام قال لأبي جعفر عليه السلام: أخبرك أطال الله بقاك وأمتعنا بك، إنا نأتيك فما نخرج من عندك حتى ترق قلوبنا، وتسلوا أنفسنا عن الدنيا، وتهون علينا ما في أيدي الناس من هذه الأموال، ثم نخرج من عندك، فإذا صرنا مع الناس والتجار أحببنا الدنيا؟

قال: فقال أبو جعفر عليه السلام: إنما هي القلوب مرة يصعب عليها الأمر ومرة يسهل، ثم قال أبو جعفر: أما إن أصحاب رسول الله صلى الله عليه وسلم قالوا: يا رسول الله نخاف علينا النفاق، قال: فقال لهم: ولم تخافون ذلك؟ قالوا: إنا إذا كنا عندك فذكرتنا روعنا، ووجلنا، نسينا الدنيا وزهدنا فيها حتى كأنا نعاين الآخرة والجنة والنار ونحن عندك، فإذا خرجنا من عندك، ودخلنا هذه البيوت، وشممنا الأولاد، ورأينا العيال والأهل والمال، يكاد أن نحول عن الحال التي كنا عليها عندك، وحتى كأنا لم نكن على شيء، أفتخاف علينا أن يكون هذا النفاق؟

فقال لهم رسول الله صلى الله عليه وسلم : كلا، هذا من خطوات الشيطان. ليرغبنكم في الدنيا، والله لو أنكم تدومون على الحال التي تكونون عليها وأنتم عندي في الحال التي وصفتم أنفسكم بها لصافحتكم الملائكة، ومشيتم على الماء، ولولا أنكم تذنبون، فتستغفرون الله لخلق الله خلقاً لكي يذنبوا، ثم يستغفروا، فيغفر الله لهم، إن المؤمن مفتن تواب، أما تسمع لقوله: ] إِنَّ اللَّهَ يُحِبُّ التَّوَّابِينَ ] وقال: ] وَأَنِ اسْتَغْفِرُوا رَبَّكُمْ ثُمَّ تُوبُوا إِلَيْهِ ] (الكافي ، الكليني ، ج2 ص 423- 424).

“Dari Salam bin al Mustanir ia berkata: Aku suatu hari berada di tempat Abu Ja’far. Kemudian datanglah Hamran bin A’yun. Dan dia pun bertanya kepadanya tentang beberapa masalah. Dan ketika Hamran ingin pamit, ia berkata kepada Abu Ja’far a.s.: “Aku ingin mengadu kepadamu -semoga Allah memanjangkan usiamu dan menjadikanmu selalu memberi manfaat bagi kami- bahwa ketika kami datang kepadamu, selama kami belum keluar pulang dari majlismu, kami merasakan hati kami menjadi lembut, jiwa kami menjadi tidak senang dunia, dan kami tidak silau dengan harta yang ada di tangan manusia. Tapi ketika kami keluar dari majlismu, dan kembali bergaul dengan orang banyak serta para pedagang, ketika itu kami kembali cinta dunia. Bagaimana itu bisa terjadi?”

Abu Ja’far a.s. menjawab: “Seperti itulah hati manusia. Terkadang sulit dikendalikan dan terkadang mudah.” Kemudian Abu Ja’far kembali berkata: “Para sahabat Rasulullah SAW juga pernah berkata: “Rasulullah SAW., kami takut mengalami nifaq”. Beliau bertanya: “Mengapa kalian berkata begitu?” Mereka menjawab, “Kami ini jika sedang bersamamu, kami merasakan jiwa kami menjadi halus dan merasakan nuansa ilahiah yang mengisi relung bathin kami. Sehingga kami pun lupa terhadap dunia dan tidak ada keinginan meraihnya. Sehingga kami seakan-akan melihat akhirat, surga dan neraka secara kasat mata, ketika kami berada bersamamu. Tapi ketika kami keluar dari majlismu, masuk kembali ke rumah kami, kemudian mencium anak-anak kami, melihat isteri dan keluarga kami, serta kembali berurusan dengan harta, maka saat itu kami merasakan mengalami perubahan dari kondisi ketika berada bersamamu, sehingga seakan-akan kami tidak memiliki perasaan tadi lagi. Apakah itu tanda kemunafikan diri kami?”

Rasulullah SAW. menjawab mereka: “Itu sama sekali bukan tanda kemunafikan kalian. Itu hanyalah salah satu bentuk godaan syetan yang ingin membujukmu agar mencintai dunia. Demi Allah, jika kalian terus berada dalam kondisi ruhaniah seperti yang kalian ceritakan sebelumnya, niscaya kalian akan disalami oleh malaikat, dan kalian bisa berjalan di atas air. Tapi jika kalian tidak berbuat dosa sehingga kemudian Allah mengampuni kalian, niscaya Allah akan menciptakan makhluk lain yang akan berbuat dosa untuk kemudian mereka bersimpuh meminta ampunan kepada Allah, dan Allah pun mengampuni mereka. Karena itulah orang beriman itu bersifat kerap mengalami fitnah (sehingga berbuat dosa) untuk kemudian meminta ampunan Allah. Apakah engkau tidak mendengar firman Allah SWT: “Sesungguhnya Allah menyukai orang-orang yang bertaubat.” (Qs. Al Baqarah 2: 222) dan firman Allah SWT: “Dan hendaklah kamu meminta ampun kepada Tuhanmu dan bertaubat kepada-Nya.” (Qs. Hud 11: 3). Lihat dalam kitab (Al-Kafi, karya Al-Kulaini, vol. 2 hal. 423-424)

.

Ja’far Shadiq, imam keenam menyatakan :

أبو عبد الله عليه السلام قال : كان أصحاب رسول الله صلى الله عليه وآله اثني عشر ألفا ثمانية آلاف من المدينة ، و ألفان من مكة ، وألفان من الطلقاء ، ولم ير فيهم قدري ولا مرجي ولا حروري ولا معتزلي ، ولا صحاب رأي ، كانوا يبكون الليل والنهار ويقولون : اقبض أرواحنا من قبل أن نأكل خبز الخمير.”  (الخصال، الشيخ الصدوق – ص 639 – 640).

“Para sahabat Rasulullah SAW. ada dua belas ribu orang. Delapan ribu orang dari Madinah, dua ribu orang dari Mekkah, dan dua ribu orang dari kalangan ath-Thulaqaa` (yang masuk Islam setelah era Fath Makkah). Dalam diri mereka tidak didapati seorangpun yang menganut paham qadariyah, atau murjiah, atau haruriah, atau mu’tazilah atau rasionalis. Mereka itu selalu menangis di waktu malam dan siang (karena rindu kepada Tuhan mereka) dan mereka berdoa: Ya Allah cabutlah nyawa kami sebelum kami sempat makan roti.” (Al Khishal, karya Syekh Shaduuq, hal. 639-640).

Imam yang kedelapan, yaitu Ali bin Musa atau yang dikenal dengan Ali ar Ridha menyatakan seperti ini:

قال علي بن موسى الملقب بالرضا – الإمام الثامن عند الشيعة – حينما سئل “عن قول النبي صلى الله عليه وسلم : أصحابي كالنجوم فبأيهم اقتديتم اهديتم ، وعن قوله عليه السلام: دعوا لي أصحابي:؟ فقال: هذا صحيح . (عيون أخبار الرضا (ع)، الشيخ الصدوق ، ج1 ص 93).

Ali bin Musa ar Ridha imam Ahlul Bait ke delapan ketika ditanya tentang sabda Nabi SAW: “Para sahabatku seperti bintang gemintang, dengan siapapun dari mereka kalian mengikut, niscaya kalian akan mendapatkan petunjuk yang benar.” Serta tentang sabda Nabi SAW.”Jangan kalian berbuat buruk kepada sahabatku.” Ali ar Ridha menjawab: “hadits itu sahih.” (‘Uyun Akbar ar Ridha, karya Syekh ash Shaduuq, juz 1 hal. 93).

Bagaimanakah kedudukan dan keutamaan Sahabat Nabi SAW. menurut imam Ahlul Bait, dalam referensi Imamiyah Ja’fariyah?

Imam ke 11, Hasan al ‘Askari berkata dalam tafsirnya:

إن كليم الله موسى سأل ربه : هل في صحابة الأنبياء أكرم عندك من صحابتي؟ قال الله عز وجل: يا موسى! أما عملت أن فضل صحابة محمد صلى الله عليه وآله على جميع صحابة المرسلين كفضل آل محمد على جميع آل النبيين وكفضل محمد على جميع المرسلين) .(تفسير الحسن العسكري ص 32).

“Kalimullah Musa pernah bertanya kepada Rabb-Nya: Apakah diantara sahabat-sahabat para nabi ada yang lebih mulia di sisi-Mu dibandingkan para sahabatku? Allah SWT. berfirman: “Musa! Apakah engkau tidak tahu bahwa keutamaan sahabat Muhammad SAW. atas seluruh sahabat para Rasul yang lain adalah laksana keutamaan keluarga Muhammad atas seluruh keluarga para nabi. Dan seperti keutamaan Muhammad atas seluruh Rasul.” (Tafsir Al-Hasan Al-’Askari, hal. 32).

Dan Al-Qur’an yang sampai kepada kita saat ini juga tidak diriwayatkan melalui Ahlu Bait. Tapi melalui jalur periwayatan para sahabat. Bagaimana jadinya jika kita menolak para sahabat sebagai jalur periwayatan Al-Qur’an dan hadits-hadits Nabi SAW? Dari mana kita mengetahui teks dan bacaan Al-Qur’an yang benar?

Oleh karena itu, tidak aneh jika para Imam dari kalangan keluarga Ali bin Abi Thalib Radhiyallahu ‘anhumengambil riwayat-riwayat Sunnah dari kalangan sahabat serta berdalil dengan perbuatan mereka. Seperti diriwayatkan dalam salah satu dari empat kitab terpenting Syi’ah Imamiyah Ja’fariyah, yaitu kitab Man La Yahdhuruhul Faqih sebagai berikut:

قال الشيخ الصدوق 4242:  وروى عبد الله بن ميمون عن أبي عبد الله ، عن أبيه عليهما الصلام قال : “:ان أصحاب رسول الله صلى الله عليه وآله بتبوك يعبون الماء ، فقال رسول الله صلى الله عليه وآله : اشربوا في أيديكم فإنها من خير آنيتكم ” . ( من لا يحضره الفقيه ج 3 ص 353)

Syekh Shaduq berkata: (4242) Abdullah bin Maimun meriwayatkan dari Abi Abdillah (Ja’far As-Shadiq) dari ayahnya ‘Alaihis salam, ia berkata: “Para sahabat Rasulullah SAW saat di Tabuk minum dengan secara langsung ke tempat air. Kemudian Rasulullah SAW bersabda: “Minumlah dengan tapak tangan kalian, karena ia adalah gelas yang paling baik bagi kalian.” (Man La Yahdhuruhu Al-Faqih, jilid. 3, hal. 353).

Imam ke 11, Hasan al ‘Askari menyatakan:

إن رجلاً ممن يبغض آل محمد وأصحابه الخيرين، أو واحداً منهم يعذبه الله عذاباً لو قسم على مثل عدد خلق الله لأهلكهم أجمعين. (تفسير الحسن العسكري ص196 ، و بحار الأنوار للمجلسي ج 26 ص 331).

“Orang yang membenci keluarga Muhammad dan para sahabatnya yang mulia, atau terhadap salah seorang dari mereka, niscaya Allah akan adzab mereka dengan adzab yang jika ditimpakan kepada seluruh makhluk Allah niscaya binasalah mereka seluruhnya.” (Tafsir al Hasan al ‘Askari, hal. 196. Juga lihat di Biharul Anwar karya Al Majlisi, juz 26, hal. 331).

Dan saya tutup ungkapan para imam Ahlul Bait itu dengan wasiat penghulu para imam Ahlul Bait, yaitu Ali bin Abi Thalib r.a. tentang para sahabat yang mulia dan persaksian ta’dil dia terhadap mereka:

وأوصيكم بأصحاب نبيكم ، لا تسبوهم ، وهم الذين لم يحدثوا بعده حدثا ، ولم يأتوا محدثا ، فإن رسول الله ( صلى الله عليه وآله) أوصى بهم.  (الأمالي ، الشيخ الطوسي ، ص 522 – 523).

“Aku berwasiat kepada kalian tentang para sahabat Nabi kalian. Jangan kalian cerca mereka. Karena mereka tidak melakukan suatu perubahan apa pun terhadap agama setelah Nabi SAW. Mereka juga tidak mendatangkan orang yang melakukan perubahan. Dan Rasulullah SAW. juga berwasiat seperti itu tentang mereka.” (Kitab Al-Amaali, karya Syekh Ath-Thuusi, hal. 522-523).

Demikianlah penuturan para imam Ahlul Bait tentang sahabat Nabi SAW

.

Mengenai sikap terhadap sahabat, kaum Syi’ah berpegang pada Al-Quran dan Sunnah serta catatan sejarah. Bahwa diantara para sahabat ada juga yang lalim 

Lihat buku-buku sejarah Islam, seperti “Riwayat Hidup Rasulullah SAW” karangan Abul Hasan Ali Al-Hasany an-Nadwy, terjemahan Bey Arifin dan Yunus Ali Muhdhar, hal. 213 atau Ibnu Hisyam, “Sirah Nabawiyah” jilid II, hal. 213. Atau Mu’awiyah dan para jendralnya yang melakukan pembersihan etnis dengan membunuh kaum Syi’ah secara berdarah dingin, shabran, menyembelih bayi-bayi Syi’ah, memperbudak para muslimah dan membakar kebun dan membakar manusia hidup-hidup, mengarak kepala dari kota ke kota, minum arak, berzina dan sengaja merencanakan dan membuat hadits hadits palsu yang bertentangan dengan hukum syar’i. Mengapa saudara tidak membaca sejarah dan hadits-hadits kita sendiri?
.
Bila saudara-saudara menganggap cerita-cerita yang membuka ‘aib’ para sahabat sebagai kufur, maka tidak akan ada lagi ahli sejarah dan ahli hadits yang tidak kafir. Syi’ah menolak hadits yang diriwayatkan oleh para sahabat lalim. Mereka heran mengapa kaum Sunnah keberatan bila mereka meriwayatkan hadits-hadits dari keluarga Rasulullah sebab ayat-ayat Al-Qur’an turun dirumah mereka
.
Dan Rasulullah tinggal serumah dan mengajari mereka? Mengapa mereka harus mencari hadits-hadits Abu Hurairah misalnya, yang meriwayatkan bahwa Allah menciptakan Adam seperti wajah Allah dengan panjang 60 hasta (sittuna dzira), sedang Al-Qur’an mengatakan bahwa tiada sesuatu pun yang menyerupaiNya, laisa kamitslihi syai’un, atau Nabi Musa lari telanjang bulat karena bajunya dibawa lari oleh batu, atau sapi berbahasa Arab, atau hadits yang menyatakan kalu lalat masuk ke dalam kuah, maka seluruh lalat harus dimasukkan kedalamnya sehingga menimbulkan ‘perang lalat’ di koran-koran Mesir karena dokter-dokter muda menolak hadits yang ‘berbahaya’ tersebut? Dan Allah yang turun ke langit bumi, sepertiga malam, sehingga Allah tidak punya kesempatan untuk kembali karena kesiangan?
.
Mengapa mereka harus berpegang pada Abu Hurairah yang oleh sahabat-sahabat besar seperti ummul mu’minin Aisyah dan Umar bin Khattab dan ulama-ulama besar seperti Ibnu Qutaibah menganggapnya sebagai pembohong? Bukankah Ibnu Qutaibah disebut sejarawan sebagai nashibi atau pembenci Ahlul Bait dan bukan Syi’ah? Baca sejarah dan hadits-hadits shahih Bukhari Muslim! Haruslah diakui bahwa pandangan Syi’ah ini berbeda dengan kaum Sunni yang menganggap semua sahabat itu adil, ‘udul, dan bila mereka membunuh atau memerangi sesama muslim, mereka akan tetap mendapat pahala. Bila tindakan mereka salah, mereka akan mendapat satu pahala dan kalau benar mendapat dua pahala.
.
Malah ada ulama Sunni, seperti Ibnu Katsir, Ibnu Hazm dan Ibnu Taymiyyah menganggap ‘Abudrrahman bin Muljam yang membacok Imam ‘Ali bin Abi Thalib yang sedang shalat shubuh sebagai mujtahid. Demikian pula pembantai Husain dan keluarganya di Karbala. Pembunuh-pembunuh cucu Rasulullah ini dianggap mendapat pahala, satu bila salah dan dua bila benar! Suatu hari, saya kedatangan tiga orang Afghanistan. Saya tanyakan, mengapa kaum muslimin di Afghanistan saling berperang? Mereka menjawab: mereka berperang karena berijtihad seperti ummul mu’minin ‘Aisyah yang memerangi ‘Ali dalam perang Jamal. Kalau benar dapat dua pahala dan kalau salah dapat satu.
.
Dan saya dengar, koran-koran Jakarta pun telah memuat keyakinan mereka ini. Kaum Thaliban di Afghanistan, yang punya pendapat seperti ini, yang mengurung dan tidak membolehkan wanita bekerja atau sekolah bukanlah Syi’ah, tetapi kaum Wahabi! Sebaliknya kaum Syi’ah juga berpendapat bahwa banyak pula sahabat yang mulia, yang harus diteladani kaum muslimin. Al-Qur’an juga menyebutkan bahwa diantara para sahabat ada yang ‘kufur’ dan ‘munafik’. (Termasuk ayat-ayat terakhir bacalah At-Taubah ayat 48, 97)
.

Banyak sekali hadits-hadits seperti hadits Al-Haudh, diantaranya tercatat dalam Shahih Bukhari dan Muslim. Mereka membenarkan ayat Al-Qur’an tersebut dan menceritakan adanya sekelompok sahabat digiring ke neraka dan tatkala ditanya Rasul, ada suara yang menjawab “Engkau tidak mengetahui apa yang mereka lakukan sesudahmu”. Ahli-ahli sejarah kita dengan gamblang menggambarkan ulah beberapa sahabat tersebut. Apakah pandangan Syi;ah tersebut ‘kufur’ atau ‘sesat’? Apakah mereka harus dikafirkan karena keyakinan mereka itu? Kita boleh menyesali perbedaan itu, tetapi perbedaan ini menyangkut masalah cabang agama bukan pokok, bukan ushuluddin

.

Mengenai mencela dan melaknat sahabat, saya belum pernah membaca fatwa ulama yang mengkafirkan mereka. Misalnya, selama 80 tahun dinasti ‘Umayyah, kecuali di zaman khalifah ‘Umar bin ‘Abdul ‘Azis yang hanya dua setengah tahun
.
Muawiyyah dan para pejabatnya serta para ulamanya melaknat dan mencaci Ali bin Abu Thalib dan keluarga beserta pengikutnya diatas mimbar diseluruh dunia Islam termasuk di Makkah dan Madinah, kecuali di Sijistan
.
Di Sijistan, sebuah kota yang sekarang terletak antara Afghanistan dan Iran, hanya sekali melakukan pelaknatan diatas mimbar.  Ali dilaknat dan dicaci atas perintah sahabat dan ipar Rasulullah SAWW, Mu’awiyyah, serta khalifah-khalifah Bani Umayyah lainnya. Pada masa itu, misalnya, Ali tidak dianggap khalifah yang lurus
.
Abdullah bin Umar tidak mau membai’at Ali malahan membai’at Mu’awiyyah, Yazid bin Mu’awiyyah dan gubernur Hajjaj bin Yusuf yang terkenal sebagai penjahat yang mebunuh 120 ribu kaum muslimin dan muslimat secara berdarah dingin, shabran. Umar bin Abul Azis mengatakan bahwa Hajjaj pasti akan menjadi juara dunia bila para penjahat dikumpulkan dan ‘diperlombakan’
.

Sahabat Nabi SAW yang mati syahid semasa Nabi SAW hidup atau wafat secara alamiah semasa Nabi SAW hidup insya Allah mayoritas selamat di Haudh kelak (dipuji syi’ah)

QS. Al-Muzzammil ayat 20

bismillah
Artinya :
Sesungguhnya Tuhanmu mengetahui bahwasanya kamu berdiri (sembahyang) kurang dari dua pertiga malam, atau seperdua malam atau sepertiganya dan (demikian pula) segolongan dari orang-orang yang bersama kamu. Dan Allah menetapkan ukuran malam dan siang. Allah mengetahui bahwa kamu sekali-kali tidak dapat menentukan batas-batas waktu-waktu itu, maka Dia memberi keringanan kepadamu, karena itu bacalah apa yang mudah (bagimu) dari Al Qur’an. Dia mengetahui bahwa akan ada di antara kamu orang-orang yang sakit dan orang-orang yang berjalan di muka bumi mencari sebagian karunia Allah; dan orang-orang yang lain lagi berperang di jalan Allah, maka bacalah apa yang mudah (bagimu) dari Al Qur’an dan dirikanlah sembahyang, tunaikanlah zakat dan berikanlah pinjaman kepada Allah pinjaman yang baik. Dan kebaikan apa saja yang kamu perbuat untuk dirimu niscaya kamu memperoleh (balasan)nya di sisi Allah sebagai balasan yang paling baik dan yang paling besar pahalanya. Dan mohonlah ampunan kepada Allah; sesungguhnya Allah Maha Pengampun lagi Maha Penyayang.

Penjelasan Syi’ah : 

Ayat ini turun berkaitan dengan Utsman bin Mazh’un. Beliau termasuk pada “segolongan/tahifah dalam Qs. Al Muzammil ayat 20

Aisyah bertutur : “Datang kepadaku istri Utsman bin Mazh’un dalam keadaan lusuh. Aku tanya mengapa. Ia berkata, “Suamiku puasa siang, shalat malam, terus menerus”. Aku ceritakan hal itu kepada Nabi SAW. Rasulullah menemui Utsman dan berkata , “Hai Utsman, kependetaan tidak diwajibkan atas kita. Tidakkah kamu mengambilku sebagai contoh  ? Demi Allah, aku paling takut kepada Allah, dan paling memelihara hukum hukumnya”

.

Q.S. Al- Maidah ayat 93

laysa ‘alaa alladziina aamanuu wa’amiluu alshshaalihaati junaahun fiimaa tha’imuu idzaa maa ittaqaw waaamanuu wa’amiluu alshshaalihaati tsumma ittaqaw waaamanuu tsumma ittaqaw wa-ahsanuu waallaahu yuhibbu almuhsiniina
.
93. Tidak ada dosa bagi orang-orang yang beriman dan mengerjakan amalan yang saleh karena memakan makanan yang telah mereka makan dahulu, apabila mereka bertakwa serta beriman, dan mengerjakan amalan-amalan yang saleh, kemudian mereka tetap bertakwa dan beriman, kemudian mereka (tetap juga) bertakwa dan berbuat kebajikan. Dan Allah menyukai orang-orang yang berbuat kebajikan.Penjelasan Syi’ah : Menurut Ibn ‘Abd Al Birr, sehubungan dengan perilaku Utsman dan sahabat sahabat yang ingin terus menerus beribadah maka turunlah Qs. Al Maidah ayat 93 (Al Isti’ab 3:186).

bismillahUtsman bin Maz`un (wafat 2 H/624 M) (Bahasa Arab عثمان بن مظعون) adalah salah satu sahabat nabi. Ia termasuk cendekiawan Arab di zaman jahiliyah, sempat mengikuti Perang Badardan meninggal dunia sekembalinya dari perang tersebut. Sepeninggal Utsman, Muhammad menciumnya sambil mengalirkan air mata. Utsman inilah sahabat pertama yang meninggal diMadinah.

Utsman inilah yang pernah berniat membujang dan meninggalkan keduniawian, akan tetapi Muhammad melarangnya dari niat tersebut. Kemudian Utsman bin Mazh’un menikah denganKhawlah binti Hakim.

Wisudawan Madrasah Rasulullah saw (1)

REFORMASI Agung kedua yang dilakukan Rasulullah adalah dengan mengubah kesetiaan kepada kelompok menjadi kesetiaan kepada Islam. Sekarang saya ingin memberikan contoh keberhasilan reformasi kedua itu melalui kehidupan beberapa sahabat yang lulus dari Madrasah Rasulullah saw. Tidak semua sahabat lulus dari Madrasah Rasulullah. Ada juga sahabat yang diskors selama tiga bulan dan semua sahabat-sahabat Nabi yang lain dilarang berbicara dengan dia. Sampai sahabat Nabi itu kemudian lari ke gunung, bertaubat siang dan malam.

Para sahabat yang lulus dari madrasah Rasulullah saw, anehnya, banyak yang tidak kita kenal. Salah seorang tokoh yang tidak begitu kita kenal adalah Utsman bin Mazh’un, dia dikuburkan di Baqi. Bapaknya adalah Mazh’un bin Wahab bin Hudzafah bin Jumuh Al-Quraisyi. Sedangkan Ibunya ialah Suhailah binti Al-Anbas bin Ahban bin Khudzafah bin Jumuh.

Utsman masuk Islam beserta seluruh keluarganya. Dia adalah orang ketigabelas yang masuk Islam. Dia sangat rajin beribadah. Ia pun hijrah dua kali ke Habsyi. Dia ikut berperang di Badar bersama Rasulullah saw. Dia meninggal dua setengah tahun setelah Hijrah. Nabi menguburkannya di Baqi dan memberi tanda di kuburan Utsman dengan batu. Nabi sering menziarahi kuburannya. Hal ini sekaligus merupakan dalil bahwa ziarah ke kubur itu ialah sunnah Rasulullah saw. Kelak, salah seorang putera Utsman syahid pada hari Yamanah, ketika kelompok Musailamah Al-Kadzab melakukan perlawanan.

Kesetiaan Utsman bin Mazh’un kepada Allah dan Rasul-Nya lebih tinggi daripada kesetiaannya kepada yang lain. Ketika orang-orang Islam dikejar-kejar dan dianiaya, Utsman hijrah ke Habsy beserta seluruh keluarganya. Seperti kita ketahui, ‘Amr bin ‘Ash menyusul ke Habsyi dan meminta Utsman supaya kembali lagi ke Mekkah. ‘Amr bin ‘Ash juga meminta kepada Raja Habsyi supaya tidak menerima umat Islam di negeri itu dan mengembalikannya ke Mekkah.

Ketika Utsman bin Mazh’un kembali dari Habsyi ke Mekkah, penindasan masih berlangsung. Orang-orang Islam masih disiksa dan dianiaya. Dia menghadapi ancaman terhadap dirinya dan keluarganya. Akhirnya dia mencari perlindungan kepada keluarga Al-Walid bin Mughirah, seorang penyair yang sejak dulu dekat dengan Utsman.

Pada awalnya, Utsman bin Mazh’un masuk Islam karena rasa malu. Rasulullah saw sering berdakwah kepadanya dan berulang kali mengajak Utsman bin Mazh’un masuk Islam. Utsman pernah berkata, “Aku ini masuk Islam karena malu saja. Rasulullah berulang kali mengajak aku untuk masuk Islam. Waktu itu Islam belum ada dalam hatiku. Sampai suatu hari aku sedang bersama Rasulullah, tiba-tiba Rasul memandang ke langit. Seakan-akan beliau sedang memahami sesuatu. Setelah Rasul merenung, aku bertanya kepada Rasul tentang apa yang terjadi. Lalu Rasul menjawab, “Allah menyuruh kamu untuk berbuat baik dan memberikan hak kepada keluargamu. Dan Allah melarang kamu dari keburukan dan kemungkaran.” (QS Al-Nahl 90).

“Waktu itu, menetaplah Islam dalam hatiku. Itulah saatnya aku masuk Islam yang sungguh-sungguh, karena aku tersentuh oleh ayat yang indah itu. Lalu aku datangi paman Nabi, Abu Thalib, dan aku kabarkan ke-islamanku. Beliau memberi nasehat, “Ya Ahli Quraisy, ikuti Muhammad, nanti kamu mendapat petunjuk. Karena Muhammad tidak memerintah kecuali kepada akhlak yang mulia.”

“Kemudian aku datangi Walid bin Mughirah, aku bacakan ayat itu dan Mughirah pun terpesona. Dia berkata, “Sungguh dalam ayat-ayat itu ada kemanisan-nya. Di atasnya juga ada keindahannya. Pada puncaknya ada buahnya. Dan di bawahnya rimbun. Ini bukan ucapan manusia. Kalau itu ucapan Muhammad, alangkah bagusnya ucapan Muhammad itu. Dan kalau itu ucapan Tuhannya, alangkah bagusnya ucapan Tuhannya itu”.

Walid bin Mughirah memang dekat dengan Utsman bin Mazh’un, meskipun dia tidak masuk Islam. Malahan ia termasuk dedengkot kekufuran. Tapi kepada Walid bin Mughirah, Utsman bin Mazh’un berlindung. Dan Walid bin Mughirah melindungi dia. Sehingga dia tidak diganggu oleh orang-orang kafir. Sementara orang-orang Islam yang lain menderita, Utsman bin Mazh’un ber-senang-senang di bawah perlindungan Walid bin Mughirah.

Utsman berkata, “Demi Allah, pagi dan soreku tentram dalam perlindungan seseorang yang musyrik. Sedangkan sahabat-sahabatku dan teman seagamaku sekarang menderita barbagai bala dan kesulitan karena Allah. Itu semua tidak menimpaku. Sungguh keadaanku ini adalah sebuah kekurangan yang besar, sebuah aib besar untuk diriku.”

Kemudian Utsman bin Mazh’un datang menemui Walid bin Mughirah, “Wahai Abâ ‘Abdi Syam, sudah selesai sekarang perlindunganmu itu. Aku kembalikan perlindunganmu itu.” Walid menjawab, “Kenapa kau kembalikan perlindungan itu, hai anak saudaraku? Apakah ada seseorang dari kaumku yang menyakitimu?” “Tidak,” jawab Utsman, “bukan karena itu. Tapi aku ingin memilih perlindungan Allah dan aku tidak ingin meminta perlindungan kepada selain Dia.” Walid berkata, “Kalau begitu, berangkatlah kamu ke mesjid dan umumkan terang-terangan bahwa kamu sudah menolak perlindunganku.” Keduanya pun lalu berangkat ke mesjid. Di sana Walid meng-umumkan, “Ini Utsman, dia menolak perlindunganku.” Utsman mengatakan, “Benar apa yang dia katakan dan dia sudah melindungi aku dengan sebaik-baiknya. Tapi aku lebih senang untuk berlindung kepada Allah saja dan karena itu aku kembalikan perlindungan Walid.”

Pada waktu itu datang rombongan tokoh-tokoh Quraisy, salah seorang di antaranya ialah Walid bin Rabiah bin Malik bin Ja’far bin Kilab dari Bani Kilab yang juga duduk di situ. Lalu ada seorang yang bernama Lubaib dari Bani Kilab yang ketika mendengar Utsman bin Mazh’un telah melepaskan perlindungan Walid bin Mughirah, dia membacakan sebuah syair, “Sungguh segala sesuatu selain Allah itu akhirnya jadi bathil.” “Shadaqta. Kamu benar”, kata Utsman. Kemudian Lubaib meneruskan syairnya, “Semua nikmat akhirnya akan berakhir juga.” Maksud Lubaib, perlindungan Mughirah itu sekarang berakhir semua. Utsman berkata, “Kamu dusta. Kenikmatan surga tidak akan pernah berakhir.” Lalu Lubaib berteriak, “Hai Quraisy, lihatlah orang yang duduk bersama kalian ini! Dia termasuk orang-orang bodoh yang meninggalkan agama kita.” Utsman terus membantahnya, sampai Lubaib marah. Kemudian salah satu telinga dan mata Utsman dipukul, sehingga matanya lebam karena pukulan.

Walid bin Mughirah, yang dulu sebagai pelindung Utsman, berada di situ dan berkata, “Hai anak saudaraku, sekiranya mata kamu itu sehat, itu karena dulu kau berada pada perlindungan yang kokoh.” Walid bermaksud menyindir Utsman. Tapi Utsman berkata, “Demi Allah, mataku yang sehat ini sekarang iri dengan mata yang lain dalam membela agama Allah.” Utsman menantang untuk dipukul lagi. Walid berkata, “Mari ke sini, Hai anak saudaraku. Kalau engkau mau, aku akan melindungimu.” “Tidak,” kata Utsman.

Ketika matanya hampir pecah karena dipukul, dia kemudian melantunkan syair yang berisi pujian tentang matanya: “Jika mataku, karena mencari rido Tuhan, mendapat pukulan tangan mulhid, ateis sesat. Tuhan Maha Pengasih telah menggantinya dengan pahala. Siapa yang mendapat rido Rahman pasti bahagia.”

Utsman bin Mazh’un adalah contoh orang yang meninggalkan kesetian kepada kelompoknya karena kesetian kepada Allah. Dia meninggalkan tribalisme menuju Tauhidul Ummah, menuju Al-Ukhuwah Al-Islamiyyah, persaudaran Islam.

Ada beberapa ayat Al-Qur’an turun berkenaan dengan Utsman bin Mazh’un. Utsman termasuk pada “segolongan” (thâifah) dalam ayat “Sesungguhnya Tuhanmu menge-tahui bahwa kamu berdiri (sembahyang) kurang dari dua pertiga malam, atau seperdua malam atau sepertiganya dan (demikian pula) segolongan dari orang-orang yang bersama kamu.” (Al-Muzammil 20). Menurut A’isyah: Datang kepadaku istri Utsman bin Mazh’un dalam keadaan lusuh. Aku tanya mengapa. Ia berkata, “Suamiku puasa siang, salat malam, terus menerus.” Datang Nabi saw. aku sebutkan hal itu. Rasulullah saw menemui Utsman dan berkata: “Hai Utsman, kependetaan tidak diwajibkan atas kita. Tidakkah kamu mengambilku sebagai contoh? Demi Allah, aku paling takut kepada Allah, dan paling memelihara hukum-hukumnya.”

Menurut Ibn ‘Abd Al-Birr, sehubung-an dengan perilaku Utsman dan sahabat-sahabat yang ingin terus menerus ibadah, turun ayat Al-Maidah 93: “Tidak ada dosa bagi orang-orang yang beriman dan mengerjakan amalan yang saleh karena memakan makanan yang telah mereka makan dahulu, apabila mereka bertakwa serta beriman, dan mengerjakan amalan-amalan yang saleh, kemudian mereka tetap bertakwa dan beriman, kemudian mereka (tetap juga) bertakwa dan berbuat kebajikan. Dan Allah menyukai orang-orang yang berbuat kebajikan.” (Al-Isti’ab 3:186).

Rasulullah mengunjunginya ketika dia sakit. Ketika dia meninggal dunia, Rasulullah saw ikut menguburkan jenazah-nya. Rasulullah saw juga menangisi kepergian Utsman bin Mazh’un. Sejak zaman Jahiliyyah, Utsman bin Mazh’un memang berakhlak bagus, apalagi setelah dia masuk Islam. Nabi berkata, “Manusia itu seperti logam. Kalau di Zaman Jahiliyyah emas, setelah Islam pun emas juga.”

Ibnu Ishaq meriwayatkan Utsman sebagai, “Orang yang paling banyak beribadah. Puasa di waktu siang hari dan shalat di malam hari. Dia menjauhi syahwat dan meninggalkan perempuan. Kemudian dia meminta izin kepada Rasulullah saw untuk mengebiri dirinya tetapi Rasulullah melarangnya. Sejak Zaman Jahilliyah, dia tidak pernah minum khamar. Dia beralasan, “Aku tidak akan minum satu minuman yang menyebabkan akal pikiranku hilang”.

“Waktu Rasulullah saw ditinggalkan oleh putranya yang sangat dicintainya, yaitu Ibrahim yang meninggal di Madinah, Nabi mendampingkan kuburannya di samping kuburan Utsman bin Mazh’un. Beliau bersabda, “Kuburkan Ibrahim di dekat pendahulu kita yang saleh.”

Utsman bin Mazh’un

Utsman bin Mazh’un
.
Tatkala cahaya agama Islam mulai bersinar dari kalbu Rasulullah saw dan dari ucapan-ucapan yang disampaikannya di beberapa majelis, baik secara diam-diam maupun terang-terangan, Utsman bin Mazh’un adalah salah seorang dari beberapa gelintir manusia yang segera menerima panggilan Ilahi dan menggabungkan diri ke dalam kelompok pengikut Rasulullah saw. Ia adalah di antara sahabat Nabi saw yang masuk Islam pada urutan keempat belas
.
Dalam kehidupannya, ia pun tidak luput dari ancaman kaum biadab golongan kuffar Qurasy yang tidak menyukai kedatangan dan keberadaan agama baru, Islam. Ia ditempa oleh berbagai derita dan siksa, sebagaimana dialami oleh orang-orang Mukmin lainnya, pengikut setia pembawa risalah baru yang lurus, Rasulullah saw.Ketika keselamatan golongan kecil dari orang-orang beriman dan teraniaya ini menjadi pilihan utama Rasulullah saw, dengan jalan menyuruhnya berhijrah ke Habsyi, maka dipilihlah seorang yang juga membawa puteranya bernama Saib, Utsman bin Mazh’un, memimpin rombongan pertama dari Muhajirin ini.

Dalam perantauannya, Utsman bin Mazh’un tidak dapat melupakan rencana-rencana jahat mereka termasuk saudara sepupunya, Umayah bin Khalaf. Dihiburlah dirinya dengan menggubah sya’ir yang berisikan sindiran dan peringatan terhadap saudaranya itu, katanya:

“Kamu melengkapi panah dengan bulu-bulunya
Kamu runcing ia setajam-tajamnya
Kamu perangi orang-orang yang suci lagi mulia
Kamu celakan ornag-orang yang berwibawa
Ingatlah nanti saat bahaya datang menimpa
Perbuatanmu akan mendapat balasan dari rakyat jelata”

Suatu ketika tersiarlah kabar bahwa orang-orang Qurasy telah beriman dan menganut agama yang dibawa oleh Rasulullah saw. Dengan hati riang dan gembira, bangkitlah orang-orang Muhajirin mengemasi barang-barangnya untuk kembali ke Mekah. Mereka sungguh telah merindukan kampung halamannya.

Akan tetapi, baru saja mereka sampai di dekat kota, ternyata berita tentang masuknya kaum Quraisy telah beriman hanyalah berita bohong belaka. Mereka benar-benar merasa terpukul dengan kejadian dan tipuan ini. Betapa tidak, untuk pergi lagi perjalanan mereka sudah terlanjur sampai dekat kota Mekah. Sementara itu, orang-orang musyrik di kota Mekah telah mendengar datangnya buronan yang telah lama mereka kejar-kejar. Perangkap-perangkap pun mereka siapkan. Takdir telah menentukannya, datanglah barisan kaum Muslimin ke tampat itu.

Untungnya, nasib baik masih menyertai Utsman bin Mazh’un sebagai pemimpin rombongan kala itu. Perlindungan ketika itu merupakan suatu tradisi di antara tradisi-tradisi Arab yang memiliki kekudusan dan sangat dihormati. Sekiranya ada seorang yang lemah yang beruntung masuk dalam perlindungan salah seorang pemuka Quraisy, maka ia akan berada dalam suatu pertahanan yang kokoh, hingga darahnya tidak boleh ditumpahkan. Hanya sebagian kecil yang dapat masuk memperoleh perlindungan itu. Termasuk di antaranya adalah Utsman bin Mazh’un yang berada dalam perlindungan Walid bin Mughirah. Ia pun selamat hingga masuk ke kota Mekah.

Di tengah keberadaan kaum Muslimin di Mekah yang dilanda kecemasan dan ketakutan karena perlakuan orang-orang musyrik, Utsman bin Mazh’un, seorang yang telah ditempa Al-Qur’an dan didikan langsung dari Rasulullah saw, merasa prihatin dan dalam dirinya timbul perasaan berontak menyikapi keadaan itu. Utsman bin Mazh’un keluar dari rumah perlindungannya dengan tekad dan niat yang bulat.

Mari kita dengarkan cerita dari saksi mata yang melukiskan kejadian peristiwa itu!

“Ketika Utsman bin Mazh’un menyaksikan penderitaan yang dialami oleh para sahabat Rasulullah saw, sementara ia sendiri pulang pergi dengan aman dan tenteram disebabkan perlindungan Walid bin Mughirah, katanya, ‘Demi Allah, sesungguhnya mondar-mandirku dalam keadaan aman disebabkan perlindungan seorang tokoh golongan musyrik, sedang teman-teman sejawat dan kawan-kawan seagama menderita adzab dan siksa yang tidak kualami, merupakan suatu kerugian besar bagiku ….’

“Lalu ia pergi mendapatkan Walid bin Mughirah, katanya, ‘Wahai Abu Abdi Syams, cukuplah sudah perlindungan Anda, dan sekarang ini saya melepaskan diri dari perlindungan Anda.’ ‘Mengapa, wahai keponakanku?’ ujar Walid. ‘Mungkin ada salah seorang anak buahku yang mengganggumu?’ ‘Tidak,’ ujar Utsman bin Mazh’un. ‘Hanya, saya ingin berlindung kepada Allah, dan tidak suka lagi kepada lain-Nya. Karenanya, pergilah Anda ke masjid serta umumkanlah maksudku ini secara terbuka seperti Anda dahulu mengumumkan perlindungan terhadap diriku!”

“Lalu, pergilah mereka berdua ke masjid, maka kata Walid, ‘Utsman ini datang untuk mengembalikan kepadaku jaminan perlindungan terhadap dirinya.’ Ulas Utsman, ‘Betullah kiranya apa yang dikatakan itu …, ternyata ia seorang yang memegang teguh janjinya …, hanya keinginan saya agar tidak lagi mencari perlindungan kecuali kepada Allah Ta’ala.”

Setelah itu, Utsman bin Mazh’un pun berlalulah, sementara di salah satu gedung pertemuan kaum Quraisy, Lubaid bin Rabi’ah menggubah sebuah syair dan melagukannya di hadapan mereka, hingga Utsman bin Mazh’un menjadi tertarik karenanya dan ikut duduk bersama mereka. Kata Lubaid:

“Ingatlah bahwa apa juga yang terdapat di bawah kolong ini selain dari Allah adalah hampa.” “Benar, ucapan Anda itu,” kata Utsman bin Mazh’un menanggapinya. Kata Lubaid lagi, “Dan semua kesenangan, tak dapat tiada lenyap dan sirna.” “Itu dusta!” kata Utsman, “Karena kesenangan surga takkan lenyap.” Kata Lubaid:

“Hai orang-orang Qurasy! Demi Allah, tak pernah aku sebagai teman duduk kalian disakiti orang selama ini. Bagaimana sikap kalian kalau ini terjadi?” Berkatalah salah seorang di antara mereka, “Si tolol ini telah meninggalkan agama kita, jadi tidak usah digubris, apa ucapannya!”

Utsman bin Mazh’un membalas ucapannya itu hingga di antara mereka terjadi pertengkaran. Dengan perasaan marah, orang itu tiba-tiba bangkit mendekati Utsman lalu meninjunya hingga tepat mengenai matanya, sementara Walid bin Mughirah masih berada di dekat itu dan menyaksikan apa yang terjadi. Maka katanya kepada Utsman, “Wahai keponakanku, jika matamu kebal terhadap bahaya yang menimpa, maka sungguh, benteng perlindunganmu amat tangguh!” Ujar Utsman, “Tidak, bahkan mataku yang sehat ini amat membutuhkan pula pukulan yang telah dialami saudaranya di jalan Allah. Dan sungguh wahai Abu Syams, saya berada dalam perlindungan Allah yang lebih kuat dan lebih mampu daripadamu.” “Ayuhlah Utsman,” kata Walid pula, “Jika kamu ingin, kembalilah masuk ke dalam perlindunganku!” “Terima kasih,” ujar Ibnu Mazh’un menolak tawaran itu. Ibnu Mazh’un kemudian meninggalkan tempat itu; Utsman pun pergi. Di tengah perjalanan menuju rumahnya, dengan hati gembira, ia mendendangkan pantun:

“Andaikata dalam mencintai ridla Ilahi
Mataku ditinju tangan jahil orang mulhidi
Maka Yang Maha Rahman telah menyediakan imbalannya
Karena siapa yang diridhai-Nya pasti berbahagia
Hai ummat, walau menurut katamu daku ini sesat
Daku ‘kan tetap dalam agama Rasul, Muhammad
Dan tujuanku tiada lain hanyalah Allah dan agama yang haq
walaupun lawan berbuat aniaya dan semena-mena.”

Utsman bin Mazh’un telah memperlihatkan kepada kita suatu teladan yang menunjukan pribadi utama yang harum semerbak disebabkan pendiriannya yang luar biasa.

Setelah tidak mendapatkan perlindungan dari Walid, Utsman bin Mazh’un mulai mendapat siksaan dari orang-orang Quraisy. Akan tetapi, karena ketabahan dan kekuatan jiwanya, penderitaannya dirasakan dengan ikhlas dan bahagia.

Suatu ketika Utsman bin Mazh’un hijrah pula ke Madinah, hingga tidak diusik lagi oleh Abu Lahab dan kawan-kawannya. Ia berangkat ke Madinah bersama rombongan sahabat-sahabat utama yang dengan keteguhan dan ketabahan hati mereka telah lulus dalam ujian yang telah mencapai puncak kesulitan dan kesukarannya.

Di Madinah, tempat hijrahnya yang baru itu, Utsman bin Mazh’un sangat tekun dan rajin beribadah: malam harinya bagai rahib dengan ibadah shalat dan dzikirnya; siang harinya bagai pahlawan dengan berjuang membela kebenaran. Dengan ketabahan dalam zuhud dan ketekunan dalam ibadahnya, ia mencapai puncak tertinggi, hingga corak kehidupannya, baik siang maupun malam dialihnya menjadi shalat yang terus-menerus dan tasbih yang tiada henti-hentinya. Rupanya ia telah memperoleh dan merasakan kemanisan beribdah kepada Allah SWT.

Dengan berpakaian usang yang telah sobek-sobek; yang ditambalnya dengan kulit unta, suatu hari ia masuk masjid, sementara Rasulullah sedang duduk-duduk bersama para sahabatnya. Rasulullah saw kemudian bertanya kepada para sahabatnya:

“Bagaimana pendapat Kalian, bila Kalian punya pakaian satu stel untuk pakaian pagi dan sore hari diganti dengan stelan lainnya … kemudian disiapkan di depan kalian suatu perangkat wadah makanan sebagai ganti perangkat lainnya yang telah diangkat … serta kalian dapat menutupi rumah-rumah kediaman kalian sebagaimana Ka’bah bertutup ….?”

“Kami ingin hal itu dapat terjadi, wahai Rasulullah,” ujar mereka, “… hingga kita dapat mengalami hidup makmur dan bahagia!” Maka sabda Rasulullah saw, “Sesungguhnya hal itu telah terjadi, kemudian Kalian sekarang ini lebih baik dari keadaan Kalian waktu lalu.”

Meskipun Utsman bin Mazh’un ikut mendengarkan percakapan itu, ia tidak terpengaruh dengan jawaban para sahabat yang mengharapkan berbagai kecukupan. Ia tetap menjalani hidup dengan bersahaja dan menghindari sejauh-jauhnya kesenangan dunia, sampai-sampai kepada urusan menggauli isterinya hendak menahan diri. Rasulullah pun memanggil dan menyampaikan kepadanya, “Sesungguhnya keluargamu itu mempunyai hak atas dirimu.”

Utsman bin Mazh’un amat dicintai oleh Rasulullah saw. Tatkala ruhnya yang suci itu berkemas-kemas hendak berangkat menuju tempat tujuannya, Rasulullah berada di sisinya. Beliau saw membungkuk dan mencium keningnya, seraya membasahi kedua pipinya dengan derai air mata. Wajah Utsman bin Mazh’un tampak bersinar gilang-gemilang saat kematiannya. Ia seorang Muhajirin yang kali pertama wafat di Madinah; juga yang pertama kali dimakamkan di Baqi’.

Bersabdalah Rasulullah saw melepas sahabatnya yang tercinta itu:
“Semoga Allah memberimu rahmat, wahai Abu Saib….
Kamu pergi meninggalkan dunia, tak satu keuntungan pun yang kamu peroleh daripadanya, serta tak satu kerugian pun yang dideritanya daripadamu.”

Sepeninggal sahabatnya itu, Rasulullah tidak melupakannya. Ketika melepas puterinya, Rukayah; ketika nyawanya hendak melayang, Beliau pun berkata:

“Pergilah susul pendahulu kita yang pilihan, Utsman bin Mazh’un!”


Orang-orang kafir Quraiys amat gusar mendengar hijrahnya beberapa kaum muslimin ke negeri Habasyah. Mereka mengutus Amr ibnul ‘Ash dan Abdullah ibnu Abdi Rabi’ah untuk membujuk Raja Habasyah agar mau mengusir kaum muslimin dari negerinya. Namun, sang Raja menolaknya. Ia tetap melindungi kaum muslimin Makkah.

rang-orang  Quraiys tak kurang akal. Beberapa waktu berselang, mereka mengabarkan kepada kaum muslimin yang hijrah, bahwa tokoh-tokoh Quraisy sudah masuk Islam. Sehingga jika mereka kembali, mereka tak lagi mengalami siksaan.

Kaum muslimin di negeri Habasyah menyambut gembira kabar ini. Mereka sudah rindu kampung halaman, dan ingin segera bertemu Rasulullah. Mereka pun segera kembali ke Makkah.

Alangkah terkejutnya mereka. Sesampai di Makkah, orang-orang kafir menangkap mereka dan menyiksa mereka. Hanya satu orang yang tak diusik. Dia adalah Utsman bin Mazh’un. Orang-orang kafir Quraisy tak berani menangkapnya, karena pamannya, Walid bin Mughirah, yang juga salah satu tokoh Quraisy telah memberikan jaminan keamanan baginya. Utsman pun selamat.

Bukannya senang dengan perlindungan ini, Utsman bin Mazh’un justru merasa sedih. Ia sedih menyaksikan saudara-saudaranya seiman mengalami penderitaan dan penyiksaan. Hatinya berontak. Ia lantas menghadap sang paman, Walid bin Mughirah yang memberikan jaminan keamanan.

“Wahai Abu Abdi Syam (sebutan penghormatan bagi Walid bin Mughirah), sejak saat ini aku melepaskan perlindungan yang telah engkau berikan padaku. Karena aku tidak ingin mendapatkan perlindungan selain dari Allah. Umumkanlah hal ini, seperti waktu engkau umumkan perlindungan atasku sebelumnya,” kata Utsman dengan suara lantang.

Sang paman tak menyangka, kemenakannya akan mengatakan hal ini. Tapi ia tak mampu menolaknya. Walid lantas mengumumkan kepada warga Makkah, bahwa ia telah melepaskan perlindungan atas Utsman bin Mazh’un.

Mendengar pengumuman ini, kaum Quraisy bergegas mendatangi Utsman dan mulai menyiksanya. Utsman menerimanya dengan lapang dada. Ia bangga karena kini menerima nasib sama dengan saudara-saudara seimannya. Ia menikmati siksaan demi siksaan itu dengan kesabaran. Baginya, lebih baik berlindung kepada Allah daripada mendapat perlindungan manusia.

Sebenarnya sang paman bersedia memberikan perlindungan lagi, agar Utsman tak lagi disiksa. Tapi, Utsman menolak tawaran itu. Dengan tenang ia berkata, “Mataku yang sehat ini memerlukan pukulan seperti yang telah dirasakan saudara-saudaraku seiman. Sebenarnya aku berada dalam perlindungan Allah, yang lebih kuat dari perlindungan yang bisa engkau berikan untukku.”

Dan kesabaran Utsman berbuah manis. Setelah berbagai siksaan dan pukulan diterimanya dengan tabah, ia pun memenuhi perintah Rasulullah untuk berangkat hijrah ke Madinah besama kaum muslimin lainnya.

Di Madinah, umat Islam dapat beribadah dengan tenang. Mereka bisa mempelajari Al-Qur’an dari Rasulullah tanpa rasa takut dan khawatir. Utsman bin Mazh’un pun menjadi sahabat yang cukup ternama. Utsman adalah orang yang ahli ibadah dan seorang zahid, waktunya habis untuk mendekatkan diri kepada Allah. Sepanjang siang dan malam ia habiskan waktu untuk shalat, membaca Al-Quran, dan puasa.

Tokoh yang satu ini termasuk kelompok yang pertama masuk Islam, yakni pada urutan yang keempatbelas. Baliau termasuk orang yang pertama juga dari kaumMuhajirin yang hijrah ke Madinah dan sekaligus menjadi orang pertama yang wafat di Medinah, karenanya menjadi yang pertama pula dari ummat Islam yang dikuburkan diBaqi.

Beliau dikenal sebagai orang yang suci dan punya kepribadian dan hati yang suci dalam beribadah kepada Allah SWT. Beliau suci bukan karena mengucilkan diri (‘Uzlah) jauh dari kehidupan yang bisa mengantarkan orang kepada kesesatan, tapi suci di tengah-tengah kehidupan masyarakat yang jahil. Corak kehidupannya sangat berbeda dengan konsep hidup kaum sufi pada umumnya yang sebagian mereka berpendapat atau memiliki prinsip “Uzlah” untuk mengambil sikap mengasingkan diri dari kelompok masyarakatnya yang tidak sejalan dengan prinsip hidup seorang mu’min

.

     Paling tidak, ada “dua” pola pendekatan yang berbeda yang dilakukan oleh umumnya orang Islam dan kelompok Sufi. Keduanya tentu saja sama-sama hidup di jalan Allah, namun dengan “Manhaj”(Metoda) yang agak berbeda dalam mengartikan “Uzlah”. Di mana yang satu mengartikannya dengan mengasingkan diri, atau hijrah dari sebuah kondisi masyarakat yang tidak kondusif untuk berkembangnya keimanan dan kesholehan seseorang. Namun, sementara yang lain tidak sependapat dengan pemaknaan “Uzlah” seperti itu
.
     Yang paling menonjol dari diri Utsman bin Mazh’un adalah “Mujahadah”nya, yakni upaya yang sungguh-sungguh untuk hidup di jalan Allah dengan melakukan semua yang dicintai Allah dan meninggalkan segala yang dibenci-Nya dan untuk itu beliau tidak pernah mengasingkan diri dari masyarakat, sebaliknya beliau senantiasa siap menghadapi segala resiko yang terjadi termasuk siap menghadapi siksaan yang sudah biasa dihadapi oleh orang-orang yang baru masuk Islam. Kala itu beliau hadapi segala macam siksaan dengan kesabaran dan tidak pernah berniat sedikit pun untuk lari dari kondisi yang dialaminya
.
     Beliau baru mau berhijrah ke Habsy setelah Rasulullah Saw memerintahkan Utsman dan para sahabat yang lain meninggalkan Mekah yang sangat tidak kondusif bagi orang-orang mu’min saat itu. Mereka pun berhijrah lalu menemukan lingkungan di Habsyi yang membuat mereka merasa aman dan nyaman serta bisa meninggalkan lingkungan para penyembah berhala yang telah membuat mereka “muak” melihatnya. Di Habsyi mereka hidup di lingkungan orang-orang Nasrani. Kedatangan mereka dimanfaatkan oleh orang-orang Nasrani untuk mendakwahi dengan maksud agar orang-orang muslim masuk dalam keyakinan mereka. Para sahabat yang hijrah ke Habsyi di bawah pimpinan Utsman bin Mazh’un, tidak mungkin mengikuti ajakan mereka lari dari satu kekufuran lalu masuk ke dalam kekufuran yang lain, keluar dari kesesatan yang satu lalu masuk ke dalam kesesatan yang lain. Karena mereka yakin, “Hanya Islamlah satu-satunya agama yang benar” (QS. Ali Imran, 3:19;85)
.
     Ketika mereka sedang menikmati kehidupan yang tenang dan nyaman dalam beribadah dan mempelajari Al Qur’an, tiba-tiba muncul berita bahwa di Mekah, orang orang Quraisy dan para tokohnya telah masuk Islam. Berita yang cukup menggembirakan ini menjadikan mereka ingin sekali segera kembali ke Mekah dan mereka pun segera bersiap-siap. Namun, pada saat akan memasuki Mekah, arulah mereka menyadari, bahwa berita tersebut hanya fitnah dan tipu daya belaka sehingga membuat Utsman dan para sahabat betul-betul merasa terpukul atas kecerobohan mereka yang tidak menyelidiki dulu kebenaran berita tersebut. Padahal, mereka saat itu sudah berada di pintu masuk kota Mekah. Sementara itu orang-orang musyirikin yang mendengar akan kehadiran mereka yang dianggap “buronan” menyambut berita tersebut dengan suka cita. Bagi orang-orang musyirikin, Utsman dan para sahabat yang mau menegakkan kebenaran dianggap “buronan”
.
     Di masyarakat Arab Jahilliyyah saat itu berlaku sistim perlindungan, di mana setiap orang bisa mencari pelindung yang tentu saja dari tokoh Quraisy yang disegani. Menyikapi situasi dan kondisi tersebut, Utsman dan para sahabat berupaya mencari perlindungan. Namun tidak semuanya berhasil. Salah satu yang berhasil adalah Utsman bin Mazh’un yang mendapat perlindungan dari Walid bin Mughirah, seorang tokoh musyirikin Quraisy yang disegani. Karena mendapat perlindungan dari Walid, maka Utsman bin Mazh’un bebas masuk ke Mekah dengan tenang, tidak ada yang berani mengganggu karena Walid sudah mengumumkan di depan masjid bahwa Utsman ada dalam perlindungannya
.
Mendapat perlindungan dari Walid sebenarnya hati Utsman kemudian menjadi sangat tidak tenang, pada saat beliau melihat saudara-saudaranya yang miskin dan lemah tidak menemukan orang untuk melindungi mereka, sehingga mereka harus menerima siksaan yang tidak tertahankan. Melihat saudara-saudaranya hidup dalam penderitaan, batin Utsman bin Mazh’un tidak rela. Akhirnya beliau memutuskan menemui Walid bin Muqhirah untuk menyatakan keinginannya melepaskan diri
.
Kisahnya dapat diikuti sebagaimana diriwayatkan oleh seorang sahabat: “Ketika Utsman bin Mazh’un melihat beberapa sahabat Rasul mengalami penderitaan yang sangat luar biasa, sementara ia aman dalam perlindungan Walid bin Mughirah, lalu ia berkata dalam hatinya, Demi Allah, sesungguhnya saat ini aku sedang berlindung kepada musuh Allah, sementara sahabat-sahabatku merasakan berbagai azab dan siksaan, maka ia pun segera menemui Walid bin Mughirah dan berkata: “Wahai Abu Abdi Syams (Walid), bebaskan aku dari perlindunganmu! Berkata Walid: Kenapa wahai anak pamanku? Sementara orang lain susah mencari pelindung kau malah minta dibebaskan dari perlindunganku, jika kulepaskan maka boleh jadi kau akan disiksa oleh kaumku. Jawab Utsman: “Tidak, aku lebih suka ada di dalam perlindungan Allah. Pergilah kau ke depan masjid umumkanlah bahwa kau sudah tidak lagi melindungi aku sebagaimana kau dulu mengumumkan perlindungan terhadapku. Lalumereka berdua pun pergi ke halaman masjid. Walid berkata, ini adalah Utsman, dia datang menemuiku untuk membebaskan dirinya dari perlindunganku. Utsman menanggapi pernyataan Walid dengan menyatakan: “Benar yang diucapkan Walid. Dia betul orang yang selama ini bertanggung jawab melindungiku, tetapi aku lebih suka untuk dilindungi oleh Allah dan aku tidak pernah sudi lagi untuk dilindungi oleh orang-orang yang dibenci oleh Allah SWT
.
Dapat kitaambil pelajaran bahwa Utsman sempat mengambil langkah yang kurang tepat, karena sesungguhnya yang tepat sebagai pelindung hanyalah Allah SWT. Karenanya ketika turun ayat 255 surah Al Baqarah, Rasul Saw segera memerintahkan kepada para sahabat yang selama ini menjadi pengawal Rasul: “Wahai saudara-saudaraku, pergilah kalian sekarang jangan lagi kalian mengawalku karena sudah ada yang mengawalku, Allah SWT”
.
Usai proses pelepasan perlindungan dari Walid, beliau menghadiri sebuah majelis orang-orang Quraisy yang sedang dipimpin oleh Lubaid bin Rabi’ah. Di dalam majelis tersebut, Lubaid bin Rabi’ah berkata: “Bukankah segala sesuatu selain Allah itu adalah hampa tidak ada nilainya sama sekali di sisi Allah?”. Kata Utsman:”Benar, apa yang kau katakan wahai Lubaid. Kata Lubaid pula: “Bukankah setiap kenikmatan suatu saat akan sirna”. Utsman menimpali pernyataan Lubaid:”Bohong, nikmat syurga tidak akan pernah sirna selama-lamanya, semua kenikmatandunia benar akan sirna tapi ada kenikmatan syurga yang tidak kalian yakini, tidak akan sirna selama-lamanya. Lubaid merasa terpotong dan terhina dengan ungkapan tersebut, padahal ia seorang tokoh Quraisy yang disegani. Lalu ia mengatakan: “Wahai kaum Quraisy, demi tuhan pernahkah kalian meliha seseorang menghinaku dalam majelis seperti ini?”. Salah seorang yang hadir di dalam majelis mengatkan:”Orang yang baru bicara ini adalah orang tolol yng baru saja meninggalkan agama nenek moyang kita, maka jangan digubris ucapannya”
.
Sejarah berulang, setiap orang yang akan kembali menegakkan ajaran Allah disebut tolol, bodoh atau idiot oleh orang-orangsesat. Padahal, yang bodoh menurut Allah adalah mereka yang tersirat dan tersurat dalam ayat 179 surah Al A’raaf, yang diantaranya adalah mereka yang memiliki akal namun tidak dipergunakan untuk berfikir di jalan Allah SWT. Utsman bin Mamh’un, menanggapi pernyataan orang tersebut sehingga terjadilah perang mulut di antara mereka, yang bersangkutan lalu berdiri dan memukul salah satu mata Utsman
.
Melihat kejadian tersebut, Walid bin Mughirah berkata :”demi tuhan wahai keponakanku, jika matamu itu kebal, kau pantas untuk melepaskan tanggungan dariku, tapi kau sudah melepaskan tanggungan itu maka aku tidak akan membelamu. Utsman berkata: “Demi Allah, sesungguhnya mataku yang satu lagi sangat membutuhkan apa yang dialami oleh mataku yang sebelah  karena dianiaya di jalan Allah. Walid berkata: “Jika kau mau, aku masih siap untuk menjadi pelindungmu. Jawab Utsman: “Tidak, tidak untuk selama-lamanya!”
.
Pergilah Utsman dengan sebelah matanya yang sakit, tetapi ia begitu luar biasa terbebas jiwanya karena ia sekarang sedang berlindung kepada Allah SWT. Suatu ketika, Rasul memerintahkan para sahabat untuk hijrah ke Medinah dan termasuklah diataranya Utsman. Di Medinah mereka bisa merasakan kekhusyuan beribadah dan kembali kesucian pribadi Utsman nampak kembali tergambar dalam hidup kesehariannya. Ia menjadi “Rahib” (orang suci) yang menghabiskan malamnya untuk beribadah dan siangnya bekerja keras, lalu terkadang malam dan siang dipakai untuk beribadah atau malam dan siang untuk berjuang termasuk berperang menghadapi orang-orang musyirikin.
utsman punya keistimewaan tersendiri dalam ber-“Zuhud”, hidupnya benar-benar-benar jauh dari kenikmatan dunia, beliau lebih suka memakai pakaian yang kasar dan tidak mengganti pakaian dan beliau tidak makan, kecuali makanan yang sangat sederhana. Pada suatu saat beliau masuk ke dalam masjid yang saat itu Rasul dan para sahabat sedang duduk-duduk, beliau masuk dengan memakai pakaian yang sangat tidak layak dipakai, melihat kondisi beliau, Rasul pun tersentuh hatinya, sementara para sahabat yang menyaksikan malah mengalirkan air mata. Beliau beribadah ternyata bukan hanya dengan meninggalkan kenikmatan dunia dalam arti makan, minum dan berpakaian, tapi pernah juga berniat untuk menjauhi istrinya. Ketika berita ini sampai kepada Rasul, maka Rasul mun menegur beliau dengan mengatakan: “Istrimu punya hak darimu”
.
Keinginan beliau senantiasa ber-“Mujahadah” inilah yang membuat Rasul sangat mencintai beliau. Karena ketika ruhnya yang suci hendak meninggalkan jasad menuju ke hadirat Allah SWT, Rasul pun berada disampingnya mendampingi sampai akhir hayatnya. Dan ketika utsman bin Mazh’un akhirnya meninggalkan alam dunia ini, Rasul menundukkan kepalanya dan mencium kening memenuhi wajah Utsman dengan air mata. Dengan iringan doa beliau; “Semoga Allah merahmatimu, wahai Utsman, kau tinggalkan alam dunia ini tidak pernah kau ambil sedikitpun keuntungan darinya, dan dunia pun tidak pernah dirugikan oleh sebab kehadiranmu”
.
Rasul tidak pernah melupakan orang yang sangat dicintainya, sepeninggal Utsman beliau selalu ingat dan memujinya di depan para sahabt, sehingga diriwayatkan saat putri Rasul, Rukayah akan meninggal dunia, Rasul berkata kepada putrinya:”Temuilah segera di alam barzah (Utsman bin Mazh’un) orang yang sangat baik dan mulia di sisi Allah SWT”
.
Seandainya anda hendak bermaksud menyusun daftar nama-nama sahabat yang Rasulullah saw. menurut urutan masa masuknya kedalam agama islam, maka pada urutan ke empat belas tentulah anda akan tempatkan Utsman bin Mazh’un.Tatkala agama islam cahayanya mulai menyinar dari kalbu Rasulullah saw dan dari ucapan-ucapan yang disampaikanya dari beberapa majelis, baik secara diam-diam maupun terang-terangan, maka Utsman bin Mazh’un adalah salah seorang dari beberapa segelincir manusia yang segera menerima panggilan Ilahi dan menggabungkan diri dari sekelompok Rasulullah.Seperti biasanya pengikut Rasulullah selalu diterpa berbagai derita dan siksaan pada saat itu.Rasulullah saw. mengutamakan keselamatan golongan kecil dari orang beriman dan teraniaya ini, dengan jalan menyuruh mereka berhijrah ke Habsyi. Dan Utsman bin Mazh’un terpilih sebagai pemimpin rombongan pertama dari Muhajirin ini. dengan putranya yang bernama Saib, dilangkahkanya kaki ke suatu negeri yang jauh menghindar dari tiap daya musuh Rasulullah dari Abu Jahal dan orang Quraisy.Dan ketika mereka berada di Habsyi, di sana mereka menghadapi suatu agama yang teratur dan tersebar luas, mempunyai gereja-gereja, rahib-rahib dan para pendeta. Dan tentulah orang-orang gereja di negeri Habsyi itu telah berusaha sekuat daya untuk menarik orang-orang Muhajirin kedalam agama mereka, dan meyakinkan kebenaran agama Masehi. Tetapi para kaum Muhajirin tidak ada yang beranjak dari kecintaan mereka yang mendalam terhadap agama islam dan terhadap Muhammad Rasulullah.Demikianlah kaum Muhajirin tinggal di Habsyi dalam keadaan aman dan tentram. Mereka senantiasa beribadan kepada Allah dengan tekun dan mempelajari ayat-ayat al-Quran yang ada pada mereka. Tiba-tiba sampailah berita kepada mereka bahwa orang-orang Quraisy telah menganut agama islam dan mengikuti Rasulullah bersujud kepada Allah.Maka bangkitlah orang-orang Muhajirin mengemas barang-barang mereka, dan bagaikan terbang mereka berangkat ke Makah dibawa kerinduan dan didorong kecintaan pada kampung halaman. Tetapi baru saja mereka sampai di kota, ternyata  masuknya orang-orang Quraisy itu hanya dusta belaka.Ketika itu mereka amat terpukul karena telah berlaku ceroboh dan amat tergesa-gesa. Tetapi betapa mereka akan kembali, padahal kota mereka telah berada di hadapan mereka. Dalam keadaan itu orang-orang musyrik di kota mekah telah mendengar  datangnya buronan yang telah lama mereka kejar-kejar dan pasang perangkap untuk menangkapnya.Perlindungan, ketika itu merupakan suatu tradisi di antara tradisi-tradisi arab yang memiliki kekudusan dan dihormati. Sekiranya ada seorang yang lemah yang beruntung masuk dalam perlindungan pemuka Quraisy, maka ia akan berada dalam suatu pertahanan yang kokoh. Diantaranya yang termasuk mendapat perlindungan adalah Utsman bin Mazh’un yang berada dalam perlindungan Walid bin Mughirah.Dalam keadaan itu, ia melihat saudara-saudara yang lain mendapat siksaan oleh kaum Quraisy yang keji, maka hatinya bergejolak, maka ia bermaksud untuk menanggalkan perlindunganya.Ia pun berkata kepada Walid bin Mughirah:“wahai Abu Abdi Syam, cukup sudah perlindungan anda, dan sekarang ini saya melepaskan diri dari perlindungan anda.”“kenapa wahai keponakanku?” ujar Walid, “mungkin ada seseorang anak buahku yang mengganggumu?”“tidak” jawab Utsman, ‘hanya saya ingin berlindung kepada Allah’.Maka Utsman pergi ke masjid dan mengumumkan penanggalan perlindunganya.Disana Utsman mendapatkan tinjuan tepat mengenai mata. Berkatalah Walid

“wahai keponakanku, jika matamu kebal terhadap bahaya yang menimpa maka sungguh, benteng perlindunganmu sangat tangguh”.

Ujar Utsman “tidak, bahkan mataku yang sehat ini amat pula membutuhkan pukulan yang telah dialami saudaranya dijalan Allah. Dan sungguh wahai Abu Syamas, saya berada dalam perlindungan Allah yang lebih kuat dan lebih mampu dari padamu.”


Dan setelah ditanggalkanya perlindungan dari Walid, maka Utsman menemui siksaan dari orang-orang Quraisy. Tetapi dengan begitu ia tidak merana, malah bahagia.

Utsman melakukan hijrah ke madinah bersama rombongan sahabat-sahabat utama dengan keteguhan dan ketabahan hati mereka. Dan di kota hijrah Madinah al-Munawwarah itu bersingkaplah kepribadian dari Utsman bin Mazh’un tak ubah bagai batu permata yang telah diasah dan kebesaran hatinya yang istimewa. Ia memiliki ciri khas dalam zuhud dan ibadahnya. Ia amat tekun dan mencapai puncak tertinggi, hingga corak kehidupanya baik siang maupun malam dialihkanya menjadi sholat  yang terus menerus dan tasbih yang tiada henti.

Rupanya ia telah merasakan manisnya keasyikan beribadah itu, iapun hendak memutuskan hubungan dengan segala kesenangan dan kemewahan dunia. Ia tak hendak memakai pakaiaan kecuali yang kasar dan tak hendak memakan makanan selain yang amat bersahaja.,

Ibnu Mazh’un amat disayangi oleh rasulullah saw dan tatkala ruhnya yang suci itu berkemas-kemas hendak berangkat, hingga demikian ia merupakan orang Muhajirin yang pertama wafat di Madinah, dan yang mula-mula merintis jalan menuju surga, maka Rasulullah saw. berada disisinya.

Rasulullah saw. membungkuk, mencium kening Ibnu Mazh’un serta membasahi kedua pipinya dengan air yang berderai dari kedua mata beliau yang diliputi santun dan duka cita hingga saat kematiannya.

Dan bersabdah Rasulullah saw. melepas sahabat yang tercinta itu:

“semoga Allah memberimu rahmat wahai Abu Saib. Kamu pergi meninggalkan dunia, tak satupun keuntungan yang kamu peroleh dari padanya serta tak satu kerugianpun yang dideritanya daripada mu.”

Dan sepeninggalan sahabatnya, Rasulullah yang amat penyantun itu tidak pernah melupakanya, selalu ingat dan memujinya. Bahkan untuk melepas putri beliau Rukayah, yakni ketika nyawanya hendak melayang, adalah kata-kata berikut:

“pergilah susul pendahulu kita yang pilihan. Utsman bin Mazh’un”

bismillah

Kisah Sahabat Nabi: Khalid bin Sa’id bin Ash, Keturunan Bani Umayyah yang dipuji syi’ah.. ia berpendirian bahwa di antara Kaum Muslimin yang lebih berhak dengan jabatan Khalifah itu, adalah salah seorang dari keturunan Hasyim, umpamanya Abbas atau Ali bin Abi Thalib.

Kisah Sahabat Nabi: Khalid bin Sa'id bin Ash, Kebesaran Jiwa Seorang Sahabat

KHALID BIN SA’ID BIN ‘ASH
ANGGOTA PASUKAN BERANI MATI ANGKATAN YANG PERTAMA

Khalid bin Sa’id bin ‘Ash dilahirkan dari suatu keluarga kaya dan mewah, tergolong kepala-kepala suku dari seorang warga Quraisy yang terkemuka dan memegang pimpinan. Dan jika hendak ditambahkan lagi sebutlah: “Bin Umaiyah bin Abdi Syamsi bin Abdi Manaf … !”

Ketika berkas cahaya mulai merayap di pelosok-pelosok kota Mekah secara diam-diam, membisikkan bahwa Muhammad orang terpercaya” itu memberitakan soal wahyu yang datang kepadanya di gua Hira’, begitu pun soal Risalah yang diterimanya dari Allah untuk disampaikan kepada hamba-hambanya, maka hati nurani Khalid dapat menangkap bisikan-bisikan tersebut dan mengakui kebenarannya . . . !

Jiwanya rasa terbang kegembiraan, seolah-olah di antaranya dengan Risalah itu sudah ada janji dari pertama …. Dan mulai­lah ia mengikuti berkas cahaya itu dalam segala liku-likunya. Dan setiap kali ia mendengarkan kelompok kaumnya mempercakap­kan Agama baru itu, ia pun duduk dekat mereka, mendengarkan­nya dengan baik disertai perasaan suka cita yang dipendam. Dari waktu ke waktu ia seolah-olah dipompa dengan kata-kata atau kalimat-kalimat mengenai peristiwa itu, yang mendorongnya untuk menyebarkan beritanya, untuk mempengaruhi orang dan mengajari mereka … !

Orang-orang yang memandang Khalid waktu itu, melihatnya sebagai seorang pemuda yang bersikap tenang, pendiam tak banyak bicara, tapi yang sebenarnya pada bathinnya dan dalam lubuk hatinya bergelora dengan hebatnya gerakan dan kegem­biraan. Di dalamnya menggelegar bunyi gendang yang di tabuh, kepakan bendera yang dinaikkan, bahana sangkakala yang ditiup . . . , nyanyian-nyanyian yang memanjatkan doa, Serta lagu-lagu pujaan yang mengagungkan Tuhan . … Pesta pora dengan segala keindahannya, dengan semua kemegahan, luapan semangat dan hiruk pikuknya . . . ! Pemuda ini menyimpan kegembiraan pesta-pora ini di dalam dadanya, ditutupnya rapat­-rapat. Karena seandainya diketahui oleh bapaknya bahwa bathin­nya sedang bersuka cita dengan da’wah Muhammad, niscaya hidupnya akan dibinasakannya dan tubuhnya akan diper­sembahkannya sebagai korban bagi tuhan-tuhan pujaan Abdu Manaf … !

Tetapi jiwa dan kesadaran bathin seseorang bila ia telah penuh sesak dengan suatu masalah, dan meluap sampai keper­mukaan, maka limpahannya tak dapat dibendung lagi …

.

Khalid pun pergilah mencari Rasulullah saw. sampai me­nemukan tempat beliau, lalu menumpahkan isi hatinya, dan menanyakan tentang da’wahnya. Jawab Nabi:

“Hendaklah engkau beriman kepada Allah yang Maha Esa semata, jangan mempersekutukan-Nya dengan suatu opapun . . . . Dan engkau beriman kepadc, Muhammad, hamba-Nya dan Rasul-Nye . . . . Dan engkau tinggalkan menyembah berhala yang tidak dapat mendengar dan tidak dapat melihat, tidak memberi mudarat dan tidak pula manfaat…” (al-Hadits)

Khalid lalu mengulurkan tangannya yang disambut oleh tangan kanan  Rasulullah saw. dengan penuh kemesraan, dan Khalid pun mengucapkan:

“Aku naik saksi bahwa tak ada Tuhan selain Allah dan aku naik saksi bahwa Muhammad Rasul Allah”

Maka terlepaslah sudah senandung jiwa dan nyanyian kalbu­nya . . . . Terlepas bebas semua gelora yang bergolak dalam bathinnya . . . dan sampailah pula berita ini kepada bapaknya….

Pada waktu Khalid memeluk Islam, belum ada orang yang mendahuluinya masuk itu kecuali empat atau lima orang, hingga dengan demikian ia termasuk dalam lima orang angkatan pertama pemeluk Islam. Dan setelah diketahui yang menjadi pelopor dari Agama ini, salah seorang di antaranya putera Sa’id bin ‘Ash maka bagi Sa’id, peristiwa itu akan menyebabkannya men. jadi bulan-bulanan penghinaan dan ejekan bangsa Quraisy, dan akan menggoncangkan kedudukannya sebagai pemimpin.

Oleh karena itu dipanggilnyalah anaknya Khalid, lalu tanya­nya: “Benarkah kamu telah mengikuti Muhammad dan mem­biarkannya mencaci tuhan-tuhan kita … ?” Jawab Khalid:

“Demi Allah, sungguh ia seorang yang benar dan sesungguh­nya aku telah beriman kepadanya dan mengikutinya . . . “.

Ketika itu bertubi-tubilah pukulan ayahnya menimpa diri­nya, yang kemudian mengurungnya dalam kamar gelap di rumahnya, lalu membiarkannya terpenjara menderita lapar dan dahaga … sedang Khalid berseru kepadanya dengan suara keras dari balik pintu yang terkunci:

“Demi Allah, sesungguhnya ia benar dan aku beriman ke­padanya!”

Jelaslah sekarang bagi Sa’id bahwa siksa yang ditimpakan kepada anaknya itu belum lagi cukup dan memadai. Oleh sebab itu dibawanya anak itu ke tengah panas teriknya kota Mekah, lalu ia menginjak-injaknya di atas batu-batu yang panasnya menyengat, selama tiga hari penuh, tanpa perlindungan dan keteduhan . . . , tanpa setetes air pun yang membasahi bibir­nya….

Akhirnya sang ayah putus asa lalu kembali pulang ke rumah­nya. Tapi di sana ia terus berusaha menyadarkan anaknya itu dengan berbagai cara baik dengan membujuk atau mengancam­nya, memberi janji kesenangan atau mempertakutinya dengan siksaan . . . tetapi Khalid berpegang teguh kepada kebenaran, Ia berkata kepada ayahnya: “Aku tak hendak meninggalkan Islam karena suatu apapun, aku akan hidup dan mati bersamanya!”

Maka berteriaklah Sa’id: — “Kalau begitu enyahlah engkau pergi dari sini, anak keparat . . . ! Demi kata kau tak boleh makan di sini . . .           Jawab Khalid: “Allah adalah sebaik-baik pemberi rizqi . . . Kemudian ditinggalkannya rumah yang penuh dengan kemewahan, berupa makanan, pakaian dan kesenangan itu, pergi memasuki kesukaran dan aral rintang­an….

Tetapi apa yang ditakutkan … ?

Bukankah ia didampingi oleh imannya … ?

Bukankah ia selalu mempertahankan kepemimpinan Hati nuraninya . . . ?

Dan dengan tegas telah menentukan nasib dirinya?

Apalah artinya lapar kalau begitu, apalah artinya halangan dan rintangan … ?

Dan bila manusia telah menemukan dirinya berada bersama kebenaran luhur seperti kebenaran yang diserukan Muham­mad saw. ini, maka masih adakah tersisa di seantero alam ini sesuatu yang berharga yang belum dimilikinya, padahal semuanya itu, bukankah Allah yang jadi pemilik dan pem­berinya … ?

Demikianlah Khalid melalui bermacam derita dengan pe­ngurbanan dan mengatasi segala halangan dan keimanan ….

Dan sewaktu Rasulullah saw. memerintahkan para shahabat­nya yang telah beriman hijrah yang kedua ke Habsyi, maka Khalid termasuk salah seorang anggota rombongan …. Ia berdiam di sana beberapa lamanya, kemudian kembali bersama kawan-kawannya ke kampung halaman mereka di tahun yang ketujuh. Mereka dapatkan Kaum Muslimin telah menyelesaikan rencana mereka membebaskan Khaibar.

Sekarang Khalid bermukim di Madinah, di tengah-tengah masyarakat Islam yang baru, di mana ia termasuk salah seorang angkatan lima pertama yang menyaksikan kelahiran Islam, dan ikut membina bangunannya. Sejak itu Khalid selalu beserta Nabi dalam barisan pertama pada setiap peperangan atau per­tempuran . . . . Dan karena kepeloporannya dalam Islam ini serta keteguhan hatinya dan kesetiaannya, jadilah ia tumpuan ke­sayangan dan penghormatan . .. . Ia memegang teguh prinsip dan pendiriannya, tak hendak menodai atau menjadikannya sebagai barang dagangan.

Sebelum Rasul wafat, beliau mengangkatnya menjadi guber­nur di Yaman. Sewaktu sampai kepadanya berita pengangkatan Abu Bakar menjadi khalifah dan pengukuhannya, ia lalu meninggalkan jabatannya datang ke Madinah.

 Tetapi ia berpendirian bahwa di antara Kaum Muslimin yang lebih berhak dengan jabatan Khalifah itu, adalah salah seorang dari keturunan Hasyim, umpamanya Abbas atau Ali bin Abi Thalib.

Pendiriannya ini dipegangnya teguh, hingga ia tidak bai’at kepada Abu Bakar . . . . Namun Abu Bakar tetap mencintai dan menghargainya, tidak memaksanya untuk mengangkat bai’at dan tidak pula membencinya karena tidak bai’at. Setiap disebut namanya di kalangan Muslimin, khalifah besar itu tetap menghargai dan memujinya, suatu hal yang memang menjadi hak dan miliknya ….

Belakangan pendirian Khalid bin Sa’id ini berubah. Tiba-tiba di suatu hari ia menerobos dan melewati barisan-barisan di mesjid, menuju Abu Bakar yang sedang berada di atas mimbar, maka Ia pun membai’atnya dengan tulus dan hati yang teguh….

Abu Bakar memberangkatkan pasukannya ke Syria, beliau menyerahkan salah satu panji perang kepada Khalid bin Sa’id, hingga dengan demikian berarti ia menjadi salah seorang kepala pasukan tentara. . . . . Tetapi sebelum tentara itu bergerak me­ninggalkan Madinah, Umar menentang pengangkatan Khalid bin Sa’id, dan dengan gigih mendesakkan usulnya kepada khalifah, hingga akhirnya beliau merubah keputusannya dalam pengangkatan ini ….

Berita itu sampailah kepada Khalid, maka tanggapannya hanyalah sebagai berikut: “Demi Allah, tidaklah kami bergem­bira dengan pengangkatan anda, dan tidak pula akan berduka dengan pemberhentian anda . . . !” Abu Bakar Shiddiq meringan­kan langkah ke rumah Khalid meminta ma’af padanya Serta menerangkan pendiriannya yang baru, dan menanyakan kepada kepala dan pemimpin pasukan mana ia akan bergabung, apakah kepada Amar bin ‘Ash anak pamannya, atau kepada Syurahbil bin Hasanah? Maka Khalid memberikan jawaban yang menunjuk­kan kebesaran jiwa dan ketaqwaannya, ujarnya: “Anak paman­ku lebih kusukai karena ia kerabatku, tetapi Syurahbil lebih kucintai karena Agamanya “‘ Kemudian dipilihnya sebagai prajurit biasa dalam kesatuan Syurahbil bin Hasanah ….

Sebelum pasukan bergerak maju, Abu Bakar meminta Syu­rahbil menghadap kepadanya lalu katanya:  ”Perhatikanlah Khalid bin Sa’id, berikanlah apa yang menjadi haknya atas anda, sebagaimana anda ingin mendapatkan apa yang menjadi hak anda daripadanya, yakni seandainya anda di tempatnya, dan ia di tempat anda . . . . Tentu anda tabu kedudukannya dalam Islam . . . Dan tentu anda tidak lupa bahwa sewaktu Rasulullah wafat, ia adalah salah seorang dari gubernurnya . . . . Dan sebenarnya aku pun telah mengangkatnya sebagai panglima, tetapi kemudian aku berubah pendirian . . . . Dan semoga itulah yang lebih baik baginya dalam Agamanya, karena sungguh, aku tak pernah iri hati kepada seseorang dengan kepemimpinan … !

Dan sesungguhnya aku telah memberi kebebasan kepadanya untuk memilih di antara pemimpin-pemimpin pasukan siapa yang disukainya untuk menjadi atasannya, maka ia lebih me­nyukai anda daripada anak pamannya sendiri ….Maka apabila anda menghadapi suatu persoalan yang membutuhkan nasihat dan buah pikiran yang taqwa, pertama-tama hendaklah anda hubungi Abu Ubaidah bin Jarrah, lalu Mu’adz bin Jabal dan hendaklah Khalid bin Sa’id sebagai orang ketiga. Dengan demi­kian pastilah anda akan beroleh nasihat dan kebaikan ….

Dan jauhilah mementingkan pendapat sendiri dengan mengabaikan mereka atau menyembunyikan sesuatu dari mereka…!

Di medan pertempuran Marjus Shufar di daerah Syria yang terjadi dengan dahsyatnya antara Muslimin dengan orang-orang Romawi, maka di antara orang-orang yang pertama yang telah pasti tersedia pahala mereka di sisi Allah, terdapat seorang syahid mulia, yang telah menempuh jalan hidupnya sejak masa remaja belia saat ia menghadapi ajal, secara benar, beriman lagi berani . . . . Kaum Muslimin yang sedang mencari-cari para syuhada sebagai qurban pertempuran, telah mendapatinya seperti sediakala: bersikap tenang, pendiam dan keras hati, lalu kata mereka: “ya Allah, berikanlah keridlaan kapada. Khalid bin Sa’id … ! “

Mush’ab bin ‘Umayr

Mush’ab bin ‘Umayr (Arabمصعب بن عمير) adalah salah seorang sahabat nabi Nabi Muhammad. Mush’ab berhasil memasukan ajaran Islam kepada Usayd bin Hudhayr dan sahabat Usayd yang bernama Sa’ad bin Mu’adz.

Biografi

Mus’ab bin Umair berasal dari keturunan bangsawan dari suku Quraisy. Ia adalah salah satu sahabat yang pertama dalam memeluk Islamsetelah Nabi Muhammad saw diangkat sebagai Nabi dan menyebarkan agama Islam.

Mus’ab bin Umair diutus oleh Nabi Muhammad saw untuk menyebarkan dan mengajarkan agama Islam di Madinah, setelah orang-orang dari Madinah datang menyatakan keislamannya. Ia di Madinah hingga Nabi Muhammad saw hijrah ke Madinah. Mus’ab bin Umair mati syahid diPertempuran Uhud.

Wisudawan Madrasah Rasulullah saw (ll)

Rasulullah saw mendo’akan Mash’ab bin Umair.

Berkenaan dengan Mash’ab, turun ayat Al-Qur’an Surat Al-Ahzab ayat 23, 

surat Al Ahzab ayat 23 :

مِنَ الْمُؤْمِنِينَ رِجَالٌ صَدَقُوا مَا عَاهَدُوا اللَّهَ عَلَيْهِ فَمِنْهُمْ مَنْ قَضَى نَحْبَهُ وَمِنْهُمْ مَنْ يَنْتَظِرُ وَمَا بَدَّلُوا تَبْدِيلًا

“Diantara orang-orang mukmin itu ada orang-orang yang menepati apa yang telah mereka janjikan kepada Allah; maka diantara mereka ada yang gugur . Dan diantara mereka ada (pula) yang menunggu-nunggu dan mereka sedikitpun tidak merubah (janjinya )”. (QS. Al Ahzab: 23)

Setiap kita sedang berjalan dalam rangka menepati janji kita kepada Allah. Diantara kita ada yang meninggal duluan, jika kita meninggal dalam berjuang dan menepati janji, maka itu adalah hal bagus dan indah. Ada diantara kita yang menunggu kapan matinya, dan itu tidaklah masalah, selama tidak merubah arah jalan kita dan tetap berpegang teguh pada komitnen dan tetap berjuang menepati janji itu.

.

Mash’ab pada suatu peristiwa  di PERANG BADAR berada di pihak Rasulullah SAW sementara keluarganya ada yang berada di pihak kemusyrikan. Turunlah QS. Mujadilah ayat 22.  Allah Subhanahu wata’ala berfirman :


لا تَجِدُ قَوْمًا يُؤْمِنُونَ بِاللَّهِ وَالْيَوْمِ الآخِرِ يُوَادُّونَ مَنْ حَادَّ اللَّهَ وَرَسُولَهُ وَلَوْ كَانُوا آبَاءَهُمْ أَوْ أَبْنَاءَهُمْ أَوْ إِخْوَانَهُمْ أَوْ عَشِيرَتَهُمْ أُولَئِكَ كَتَبَ فِي قُلُوبِهِمُ الإيمَانَ وَأَيَّدَهُمْ بِرُوحٍ مِنْهُ وَيُدْخِلُهُمْ جَنَّاتٍ تَجْرِي مِنْ تَحْتِهَا الأنْهَارُ خَالِدِينَ فِيهَا رَضِيَ اللَّهُ عَنْهُمْ وَرَضُوا عَنْهُ أُولَئِكَ حِزْبُ اللَّهِ أَلا إِنَّ حِزْبَ اللَّهِ هُمُ الْمُفْلِحُونَ

Artinya :

“Kamu tak akan mendapati kaum yang beriman pada Allah dan hari akhirat, saling berkasih-sayang dengan orang-orang yang menentang Allah dan Rasul-Nya, sekalipun orang-orang itu bapak-bapak, atau anak-anak atau saudara-saudara ataupun keluarga mereka. Meraka itulah orang-orang yang telah menanamkan keimanan dalam hati mereka dan menguatkan mereka dengan pertolongan yang datang daripada-Nya. Dan dimasukan-Nya mereka ke dalam surga yang mengalir di bawahnya sungai-sungai, mereka kekal di dalamnya. Allah ridha terhadap mereka, dan merekapun merasa puas terhadap (limpahan rahmat)-Nya. Mereka itulah golongan Allah. Ketahuilah, bahwa sesungguhnya hizbullah itu adalah golongan yang beruntung.”

Para sahabat yang lulus dari madrasah Rasulullah saw melaksanakan ajaran reformasi Rasul dalam kehidupan mereka dengan cara meninggalkan kesetiaan mereka kepada kelompok menuju kesetiaan kepada Islam.

Salah satu contoh yang paling baik untuk menjelaskan hal itu adalah Mash’ab bin Umair, salah seorang wisudawan madrasah Rasulullah. Riwayat singkatnya sebagai berikut; Bapaknya adalah Umair bin Hasyim bin Abdi Manaf bin Abdi Dar bin Qusyaiy bin Kilab. Dari jalur kakeknya, Mash’ab bersambung dengan Rasulullah saw.

Mash’ab bin Umair adalah seorang pemuda Mekkah yang terkenal sebagai remaja berwajah tampan, tegap, dan murah senyum. Dia termasuk Assâbiqun fîl Islâm. Ia bergelar Abu Muhammad sedangkan laqabnya adalah Mash’ab Al-Khair, Mash’ab Si Baik.

Mash’ab termasuk salah seorang yang hijrah ke Habsyi. Nabi saw mengutusnya sebagai mubaligh, mu’alim, dan mursyid ke Madinah. Berkat dakwah Mash’ab bin Umair, banyak kabilah Anshar yang masuk Islam. Dia ikut bersama Nabi dalam perang Badar. Pada perang Uhud, Nabi memberinya bendera pasukan dan ia pun gugur sebagai seorang syuhada di Perang Uhud

.
Ibnu Ishaq berkata, “Ketika kaum itu (orang-orang Madinah) hendak kembali, Rasulullah saw. mengutus Mush’ab bin ‘Umair agar menemani mereka. Dia diperintah Rasul agar membacakan al-Quran, mengajarkan Islam, dan memberi pemahaman agama kepada mereka.”

Setibanya di Madinah, beliau tinggal di rumah Sa’ad bin Zurarah. Selama di Madinah, kesehariannya diisi dengan mengajak para penduduknya untuk masuk Islam dan membacakan al-Quran kepada mereka secara door to door. Hasilnya, seorang demi seorang dari mereka bersyahadat.

Kesuksesan Mush’ab dalam mengislamkan penduduk Madinah bikin gerah Sa’ad bin Muadz, pemuka kaum bani ‘Abd al-Asyhal di Madinah. Sa’ad makin benci dengan Mush’ab ketika sepupunya, Usaid bin Hudhair, yang disuruh untuk menegur Mushab malah ikut masuk Islam. Sa’ad bergegas menemui Mushab. Di hadapan Mushab dan As’ad, Sa’ad ngomel-ngomel. Tapi apa respon Mushab?

“Ataukah Tuan berkenan duduk, lalu mendengarkan,” ajak Mush’ab pada Sa’ad dengan kata-kata yang halus. “Jika Tuan meridai perkara [yang hendak saya paparkan] ini dan Tuan menyukainya, Tuan bisa menerimanya. Jika Tuan membencinya, kami menyingkir darimu yang memang Tuan membencinya.”

“Ya, saya menerima. Itu adil,” jawab Sa’ad. Mush’ab menatapnya sejenak dengan muka manis, lalu memaparkan Islam dan membacakan al-Qur’an kepadanya. Sa’ad bertanya kepada keduanya, “Apa yang kalian lakukan ketika masuk Islam dan masuk agama ini?”

“Mandi dan sucikan diri dan pakainmu, kemudian bacalah kesaksian yang haq, lalu salatlah dua rakaat,” jelas Mush’ab dan As’ad.

Sa’ad berdiri, lalu mandi dan menyucikan pakaiannya, kemudian membaca syahadat dan salat dua rakaat, kemudian segera menuju kaumnya. Ketika sudah tiba Sa’ad berkata, “Ketahuilah! Sesungguhnya ucapan kaum pria dan wanita kalian terhadapku adalah haram hingga kalian beriman kepada Allah dan Rasul-Nya.”

Selang beberapa waktu, Mush’ab dan As’ad berkata, “Demi Allah, semenjak itu di rumah bani ‘Abd al-Asyhal tidak satupun laki-laki dan wanita kecuali muslim.”

Dalam waktu satu tahun, Mush’ab berhasil membalik kekufuran di Madinah, dari keberhalaan yang bodoh dan masya’ir (perasaan-perasaan) yang salah menjadi agama tauhid dan iman serta masya’ir Islam. Gimana dengan kita? Kita bisa seperti Mush’ab asal mau tetep semangat untuk ngaji dan dakwah. Oke?

Pada umumnya, orang-orang yang masuk Islam itu kebanyakan miskin, para mustadh’afin yang berasal dari keluarga sengsara, kecuali Mash’ab bin Umair. Mash’ab adalah anak seorang keluarga elit. Orang tuanya kaya raya. Ibunya sangat sayang kepadanya sehingga dia selalu diberi pakaian yang bagus-bagus dan indah-indah.

Ketika dia masuk Islam, ibunya marah-marah dan tidak mau menerimanya lagi. Mash’ab diusir dari rumahnya. Ibunya pun pernah mogok makan dan hanya mau makan bila Mash’ab bin Umair kembali lagi memeluk agamanya semula. Tetapi Mash’ab bin Umair bertahan dan akhirnya ibunya menghentikan mogok makannya. Mash’ab bin Umair sangat mencintai ibunya tetapi dia lebih mencintai Islam. Dia mendahulukan kesetia-an kepada Islam dari pada kesetiaan kepada keluarganya.

Umar bin Khathab meriwayatkan kisah Mash’ab dalam sebuah hadits sebagai berikut; “Pada suatu hari, Rasulullah saw melihat Mash’ab bin Umair di Madinah. Mash’ab datang dengan pakaian yang compang-camping, sebagian pakaiannya dijahit dari kulit domba. Rasul menangis, lalu ia bersabda kepada para sahabatnya, “Lihat, itu orang yang telah Allah sinari hatinya. Dahulu aku pernah melihatnya berada di tengah orang tuanya yang memberinya makanan yang lezat, minuman yang enak, dan pakaian yang bagus. Kemudian kecinta-an kepada Allah dan Rasul-Nya membawanya kepada keadaan yang kalian lihat.”

Mash’ab bin Umair diutus oleh Rasulullah saw sebagai mubaligh di Madinah, atas permintaan orang-orang Anshar pada Bai’at Aqabah yang pertama. Mash’ab berdakwah dengan senyuman. Rasulullah saw tahu, orang-orang Arab itu jarang ada yang ramah dan mereka sukar sekali untuk tersenyum. Sampai Nabi pernah mengingat-kan kepada mereka berkali-kali, “Senyum kepada saudaramu itu shadaqah.” Mash’ab bin Umair menaklukkan hati orang dengan senyuman dan keramahannya.

Berikut ini adalah kisah sebagian dakwahnya di Madinah; Orang yang pertama masuk Islam di tangan Mash’ab bin Umair adalah As’ad bin Jurarah. Mash’ab bin Umair tinggal bersamanya. Kedua orang itu men-datangi satu kabilah di kalangan penduduk Madinah yang sangat berpengaruh, untuk berdakwah. Pemimpin kabilah itu adalah Sa’ad bin Mu’adz dan Usaid bin Hudair.

Mereka masuk melalui dinding Bani Zhafar. Dulu, setiap kabilah membatasi kampungnya dengan dinding-dinding. Semacam benteng yang mempunyai pintu gerbang. Begitupun dengan kota-kotanya. Kedua pemimpin kabilah itu masih musyrik. Ketika mendengar kedatangan Mash’ab dan As’ad, Sa’ad bin Mu’adz berkata pada Usaid bin Hudair, “La aban laka, mudah-mudahan kamu tidak punya bapak. Berangkatlah kamu menemui kedua orang itu yang sudah mendatangi perkampungan kita dan menipu orang-orang bodoh di kalangan kita. Sekira-nya dia tidak datang bersama As’ad bin Jurarah dan sekiranya kamu bukan merupa-kan keluarga As’ad bin Jurarah, aku sudah bunuh dia.”

Usaid bin Hudair lalu mengambil tombaknya untuk menemui kadua mubaligh itu. Ketika As’ad bin Jurarah melihat dia, dia berkata kepada Mash’ab bin Umair, “Inilah pemimpin kaum datang, dakwahi dia kepada Islam.” Mash’ab menjawab, “Kalau dia duduk, aku akan bicara dengan dia.”

Begitu Usaid bin Hudair tiba, ia langsung memaki-maki Mash’ab bin Umair. Mash’ab hanya tersenyum menghadapi makian tersebut. Usaid memaki, “Mau apa kalian datang kepada kami ini lalu menipu orang-orang bodoh di antara kami. Pergi! Kalau kalian masih memerlukan nafas kalian.”

Mash’ab bin Umair berkata, “Bagai-mana kalau anda duduk sebentar. Kita ngobrol-ngobrol. Kalau Engkau senang, Engkau terima. Kalau engkau tidak senang, Engkau dijauhkan dari apa yang tidak Engkau senangi.” Orang itu luluh melihat kebaikan hati Mash’ab bin Umair. Dia berkata, “Engkau benar.”

Kemudian Usaid meletakkan tombak-nya dan duduk bersama mereka. Mash’ab bin Umair lalu menerangkan tentang Islam. Ia membaca Al-Qur’an. Ketika melihat Usaid bin Hudair mendengarkan dengan penuh perhati-an, kedua mubaligh itu berkata, “Demi Allah aku sudah melihat di wajahnya keislaman, sebelum dia berbicara dan menunjukkan keramahan.”

Usaid bin Hudair bertanya, “Alangkah indahnya pembicaraan kamu itu. Kalau ada orang yang mau masuk Islam bagaimana caranya?” Keduanya berkata kepada Usaid, “Engkau mandi. Engkau bersuci. Bersihkan kedua pakaianmu, kemudian Engkau meng-ucapkan kalimat syahadat, setelah itu, Engkau shalat.”

Akhirnya Usaid bin Hudair berdiri. Ia mandi, membersihkan pakaiannya, kemudian dia mengucapkan syahadat dan salat dua rakaat. Usaid, yang diutus oleh kawannya Sa’ad bin Mu’adz untuk megusir mereka itu, malah masuk Islam dan berkata, “Sesungguh-nya di belakangku ada seorang tokoh. Jika tokoh itu ikut kepadamu, tidak ada seorang pun di antara kaumnya yang akan membatah-nya. Aku akan utus dia untuk menemui kamu sekarang, Sa’ad bin Mu’adz namanya.”

Usaid mengambil lagi tombaknya dan pergi menemui Sa’ad bin Mu’adz beserta kaumnya. Sa’ad sedang duduk di tengah-tengah kabilahnya. Ketika melihat Usaid datang, Sa’ad berkata, “Demi Allah! Usaid telah datang dengan wajah yang yang berbeda daripada ketika ia pergi tadi.” Saat Usaid duduk di tengah kelompok itu, Sa’ad bertanya kepadanya, “Apa yang terjadi?” Usaid pun menjawab, “Aku sudah berbicara dengan kedua orang itu. Dan Demi Allah, aku tidak melihat niat yang buruk pada mereka. Aku larang mereka untuk menemui kita, tapi mereka berkata, ‘Aku akan lakukan apa yang kalian kehendaki. Namun aku dengar Bani Haritsah sudah keluar untuk membunuh Ibnu Jurarah. Mereka tahu bahwa anak bibimu itu akan menyerang kamu, karena itu mereka akan membunuhnya’.”

Sa’ad bin Mu’adz marah. Usaid membohongi Sa’ad, supaya Sa’ad marah dan menemui Ibnu Jurarah karena kuatir Ibnu Jurarah akan diserang oleh Bani Haritsah. Sa’ad mengambil tombaknya, kemudian pergi menemui Mash’ab dan As’ad. Ketika Sa’ad melihat keduanya dalam keadaan tenang. Tahulah Sa’ad bahwa Usaid hanya mendorong dia supaya mendengarkan pembicaraan mereka.

Sa’ad berdiri dan memaki-maki. Seperti biasa, Mash’ab membalasnya dengan senyuman. Dia berkata kepada Asad bin Jurarah, “Yâ Abâ Umamah, sekiranya di antara kita ini tidak ada hubungan kekeluar-gaan, aku tidak akan sampai pada keadaan seperti sekarang ini.” Lalu Asad berkata kepada Mash’ab, “Ini sudah datang pemimpin yang diikuti oleh seluruh kaumnya di belakang. Jika ia mengikutimu, tidak seorang pun di antara kaumnya yang akan mem-bantahnya.”

Mash’ab dengan ramah mengajaknya duduk dan mendengarkan pembicaraannya. Sama seperti kepada Usaid, ia berkata, “Kalau engkau suka, engkau terimalah pembicaraan-ku. Tapi kalau engkau tidak suka, tinggalkan-lah apa yang tidak engkau sukai.” Kemudian Mash’ab pun duduk membaca Al-Qur’an. Singkat cerita, karena keramahan Mash’ab, Sa’ad bin Mu’adz akhirnya masuk Islam.

Dalam Bahasa Parsi, wajah yang ramah disebut hulu adapun wajah yang menakutkan disebut lulu. Saya pernah mendengar sebuah puisi Parsi sebagai berikut, “Orang-orang ‘Irfan memperkenalkan agama dengan hulu. Sedangkan para Fuqaha memperkenalkan agama dengan lulu.” Mash’ab bin Umair adalah orang yang memperkenalkan agama dengan wajah yang ramah. Orang yang mencaci maki tidak dilawan cacian dan makian. Malahan ia tersenyum, seakan-akan ia menikmati cacian itu. Dengan keramahannya, luluhlah hati orang-orang Anshar itu.

Usaid bin Hudair dan Sa’ad bin Mu’adz lalu menemui kaumnya. Sa’ad berkata kepada kaumnya, “Ya Bani Abdil Asyhal, bagaimana menurut kalian urusanku di tengah-tengah kalian?” Kaumnya menjawab, “Engkau adalah pemimpin kami yang paling akrab diantara kami. Yang paling bagus pemikirannya. Kau adalah pemimpin yang paling bisa dipercaya.” Kemudian Sa’ad berkata, “Ketahuilah mulai saat ini, kalian, baik laki-laki maupun perempuan, haram berbicara denganku sebelum kalian beriman kepada Allah dan Rasul-Nya.” Sa’ad ber-maksud untuk memutuskan hubungan tribalisme itu.

Berkat bantuan kedua orang ini, akhirnya Mash’ab dan Asad mendatangi seluruh perkampungan Anshar. Sehingga tidak ada lagi di antara mereka yang tidak masuk Islam.
Kisah lain meriwayatkan Mash’ab pada suatu peristiwa di Perang Badar. Mash’ab bin Umair berada di pihak Rasulullah saw sementara keluarganya berada di pihak Musyrikin.
Seperti kita ketahui, pada Perang Badar orang Islam memetik kemenangan. Di antara tawanan yang berada di tangan kaum Muslimin adalah saudara Mash’ab bernama Abu Aziz Ibnu Umair. Mash’ab melewatinya dan melihat saudaranya tertawan. Abu Aziz adalah pemegang bendera Kaum Musyrikin. Ketika saudaranya menegur dan meminta pertolongannya, Mash’ab bin Umair berbicara kepada orang Anshar yang menawan saudara-nya, “Pegang tawanan ini kuat-kuat. Ibunya orang kaya. Mudah-mudahan ibunya bisa menebus dia dengan harga yang mahal”.

“Saudaraku, apakah ini nasihatmu kepadaku?” tanya saudaranya kebingungan. Mash’ab berkata kepada Abu Aziz sambil menunjuk orang Anshar yang menawannya, “Dia (orang Anshar) adalah saudaraku yang lebih dekat denganku dari pada kamu. Dia adalah saudaraku selainmu”.

Jadi, menurut Mash’ab, saudara seagama itu jauh lebih dekat dari pada saudara sedarah.
Tarikh yang saya kutip ini mengakhiri kisah Mash’ab bin Umair dengan Surat Hud ayat 46 yang mengisahkan Doa Nabi Nuh, ketika ia ingin menolong anaknya yang tenggelam. Nuh berdoa, “Tuhanku, ini anakku termasuk keluargaku. Dan janji-Mu benar, Engkaulah hakim yang paling bijaksana.” Lalu Tuhan berfirman, “Hai Nuh, dia bukan dari keluargamu. Dia adalah amal yang tidak shaleh. Dan janganlah kamu minta kepadaku yang kamu tidak punya ilmunya. Aku nasihati kamu supaya kamu tidak termasuk orang-orang yang jahil.”

.

Suatu saat Mush’ab dipilih Rasulullah untuk melakukan suatu tugas maha penting saat itu. Ia menjadi duta atau utusan Rasul ke Madinah untuk mengajarkan seluk beluk Agama kepada orang – orang Anshar yang telah beriman dan baiat kepada Rasulullah di bukti Aqabah. Disamping itu mengajak orang-orang lain untuk menganut agama Allah, serta mempersiapkan kota Madinah untuk menyambut hijratul Rasul sebagai peristiwa besar.

Sebenarnya di kalangan sahabat ketika itu masih banyak yang lebih tua, lebih berpengaruh dan lebih dekat hubungan kekeluargaannya dengan Rasulullah daripada Mush’ab. Tetapi Rasulullah menjatuhkan pilihannya kepada “Mush’ab yang baik”.  Dan bukan tidak menyadari sepenuhnya bahwa beliau telah memikulkan tugas amat penting ke atas pundak pemuda itu, dan menyerahkan kepadanya tanggung jawab nasib agama Islam di kota Madinah, suatu kota yang tak lama lagi akan menjadi kota tempatan atau kota hijrah, pusat dari dai dan dakwah, tempat berhimpunnya penyebar Agama dan pembela al-Islam.

Mush’ab memikul amanat itu dengan bekal karunia Allah kepadanya berupa fikiran yang cerdas dan budi yang luhur. Dengan sifat zuhud, kejujuran dan kesungguhan hati, ia berhasil melunakkan dan menawan hati penduduk Madinah hingga mereka berduyun-duyun masuk Islam.

Sesampainya di Madinah, didapatinya Kaum Muslimin di sana tidak lebih dari dua belas orang, yakni hanya orang-orang yang telah baiat di bukit Aqabah. Tetapi tiada sampai beberapa bulan kemudian, meningkatlah orang yang sama-sama memenuhi panggilan Allah dan Rasul-Nya.

Pada musim haji berikutnya dari perjanjian Aqabah, kaum muslimin Madinah mengirim perutusan yang mewakili mereka menemui Nabi. Dan perutusan itu dipimpin oleh guru mereka , oleh duta yang dikirim Nabi kepada mereka, yaitu Mush’ab bin Umair.

Dengan tindakannya yang tepat dan bijaksana, Mush’ab bin Umair telah membuktikan bahwa pilihan Rasulullah saw. atas dirinya itu tepat. Ia memahami tugas dengan sepenuhnya, hingga tak terlanjur melampaui batas yang telah ditetapkan. Ia sadar bahwa tugasnya adalah menyeru kepada Allah, menyampaikan berita gembira lahirnya suatu Agama yang mengajak manusia mencapai hidayah Allah, membimbing mereka ke jalan yang lurus. Akhlaqnya mengikuti pola hidup Rasulullah yang diimaninya, yang mengemban kewajiban hanya menyampaikan belaka.

Di Madinah Mush’ab tinggal sebagai tamu di rumah As’ad bin Zararah. Dengan didampingi As’ad, ia pergi mengunjungi kabilah -kabilah, rumah-rumah dan tempat-tempat pertemuan, untuk membacakan ayat-ayat Kitab Suci Allah, menyampaikan kalimatullah “bahwa Allah Tuhan Maha Esa” secara hati-hati.

Pernah ia menghadapi beberapa peristiwa yang mengancam keselamatan diri serta sahabatnya, yang nyaris celaka kalau tidak karena kecerdasan akal dan kebesaran jiwanya. Suatu hari, ketika ia sedang memberikan petuah kepada orang-orang, tiga-tiba disergap Usaid bin Hudlair kepala suku kabilah Abdul Asyhal di Madinah. Usaid menodong Mush’ab dengan menyentakkan lembingnya. Bukan main marah dan murkanya Usaid, menyaksikan Mush’ab yang dianggap akan mengacau dan menyelewengkan anak buahnya dari agama mereka, serta mengemukakan Tuhan Yang Maha Esa yang belum pernah mereka kenal dan dengar sebelum itu. Padahal menurut anggapan Usaid, tuhan-tuhan mereka yang bersimpuh lena di tempatnya masing-masing mudah dihubungi secara kongkrit. Jika seseorang memerlukan salah satu diantaranya, tentulah ia akan mengetahui tempatnya dan segera pergi mengunjunginya untuk memaparkan kesulitan serta menyampaikan permohonan. Demikianlah yang tergambar dan terbayang dalam fikiran suku Abdul Asyhal. Tetapi Tuhannya Muhammad saw. – yang diserukan beribadah kepada-Nya – oleh utusan yang datang kepada mereka itu, tiadalah yang mengetahui tempat-Nya dan tak seorangpun yang dapat melihat-Nya.

Demi dilihat kedatangan Usaid bin Hudlair yang murka bagaikan api sedang berkobar kepada orang-orang Islam yang duduk bersama Mush’ab, mereka pun merasa kecut dan takut. Tetapi “Mush’ab yang baik” tetap tinggal tenang dengan air muka yang tidak berubah.

Bagaikan singa hendak menerkam, Usaid berdiri di depan Mush’ab dan Sa’ad bin Zararah, bentaknya: “Apa maksud kalian datang ke kampung kami ini, apakah hendak membodohi rakyat kecil kami? Tinggalkan segera tempat ini, jika tak ingin segera nyawa kalian melayang!”

Seperti tenang dan mantapnya samudera dalam, laksana terang dan damainya cahaya fajar, terpancarlah ketulusan hati ”Mush’ab yang baik”, dan bergeraklah lidahnya mengeluarkan ucapan halus, katanya “Kenapa anda tidak duduk dan mendengarkan dulu? Seandainya anda menyukai nanti, anda dapat menerimanya. Sebaliknya jika tidak, kami akan menghentikan apa yang tidak anda sukai itu!”

Sebenarnya Usaid seorang berakal dan berfikiran sehat. Dan sekarang ini ia diajak oleh Mush’ab untuk berbicara dan meminta pertimbangan kepada hati nurani sendiri. Yang dimintanya hanyalah agar ia bersedia mendengarkan dan bukan lainnya. Jika ia menyetujui, ia akan membiarkan Mush’ab, dan jika tidak, maka Mush’ab berjanji akan meninggalkan kampung dan masyrakat mereka untuk mencari tempat dan masyarakat lain, dengan tidak merugikan ataupun dirugikan orang lain.

“Sekarang saya insaf”, ujar Usaid, lalu menjatuhkan lembingnya ke tanah dan duduk mendengarkan. Demi Mush’ab membacakan ayat-ayat Al-Quran dan mengajarkan dakwah yang dibawa oleh Muhammad bin Abdullah saw, maka dada Usaid pun mulai terbuka dan bercahaya, beralun berirama mengikuti naik turunnya suara serta meresapi keindahannya. Dan belum lagi Mush’ab selesai dari uraiannya. Usaidpun berseru kepadanya dan kepada sahabatnya, ”Alangkah indah dan benarnya ucapan itu! Dan apakah yang harus dilakukan oleh orang yang hendak masuk Agama ini?” Maka sebagai jawabannya gemuruhlah suara tahlil, serempak seakan hendak menggoncangkan bumi. Kemudian ujar Mush’ab, ”Hendaklah ia mensucikan diri, pakaian dan badannya, serta bersaksi bahwa tiada Tuhan yang haq diibadahi melainkan Allah”.

Beberapa lama Usaid meninggalkan mereka, kemudian kembali sambil memeras air dari rambutnya, lalu ia berdiri sambil menyatakan pengakuannya bahwa tiada Tuhan yang haq diibadahi melainkan Allah dan bahwa Muhammad itu utusan Allah.

Secepatnya berita itu pun tersiar. Keislaman Usaid disusul oleh kehadiran Sa’ad bin Mu’adz. dan setelah mendengarkan uraian Mush’ab, Sa’ad merasa puas dan masuk Islam pula.

Langkah ini disusul pula oleh Sa’ad bin Ubadah. Dan dengan keislaman mereka ini, berarti selesailah persoalan dengan berbagai suku yang ada di Madinah. Warga kota Madinah saling berdatangan dan tanya bertanya sesama mereka, “Jika Usain bin Hudlair, Saad bin ‘Ubadah dan Sa’ad bin Mu’adz telah masuk Islam, apalagi yang kita tunggu. Ayolah kita pergi kepada Mush’ab dan beriman bersamanya! Kata orang, kebenaran itu terpancar dari celah-celah giginya!”

—oo—

Demikian duta Rasulullah yang pertama telah mencapai hasil gemilang yang tiada taranya, suatu keberhasilan yang memang wajar dan layak diperolehnya. Hari-hari dan tahun-tahun pun berlalu, dan Rasulullah bersama para sahabatnya hijrah ke Madinah.

Orang-orang Quraisy semakin geram dengan dendamnya, mereka menyiapkan tenaga untuk melanjutkan tindakan kekerasan terhadap hamba-hamba Allah yang shalih. Terjadilah perang Badar dan kaum Quraisypun beroleh pelajaran pahit yang menghabisakan sisa-sisa fikiran sehat mereka, hingga mereka berusaha untuk menebus kekalahan. Kemudian datanglah giliran perang Uhud, dan Kaum Muslimin pun berisap-siap mengatur barisan. Rasulullah berdiri di tengah barisan itu, menatap setiap wajah orang beriman menyelidiki siapa yang sebaiknya membawa bendera. Maka terpanggilah “Mush’ab yang baik”, dan pahlawan itu tampil sebagai pembawa bendera.

Peperangan berkobar lalu berkecamuk dengan sengitnya. Pasukan panah melanggar tidak mentaati peraturan Rasulullah, merek meninggalkan kedudukannya di celah bukit setelah melihat orang-orang musyrik menderita kekalahan dan mengundurkan diri. Perbuatan mereka itu secepatnya merubah suasana, hingga kemenangan kaum muslimin beralih menjadi kekalahan.

Dengan tidak diduga pasukan berkuda Quraisy menyerbu Kaum Muslimin dari puncak bukit, atau tombak dan pedang pun berdentang bagaikan mengamuk, membatasi Kaum Muslimin yang tengah kacau balau. Melihat barisan Kaum Muslimin porak poranda, musuhpun menunjukkan serangan ke arah Rasulullah dengan maksud menghantamnya.

Mush’ab bi Umair menyadari suasana gawat ini, Maka diacungkannya bendera setinggi-tingginya dan bagaikan ngauman singa ia bertakbir sekeras-kerasnya, lalu maju ke muka, melompat, mengelak dan berputar lalu menerkam. Minatnya tertuju untuk menarik perhatian musuh kepadanya dan melupakan Rasulullah saw. dengan demikian dirinya pribadi bagaikan membentuk barisan tentara.

Sungguh, walaupun seorang diri, tetapi Mushab bertempur laksana pasukan tentara besar. Sebelah tangannya memegang bendera bagaikan tameng kesaktian, sedang yang sebelah lagi menebaskan pedang dengan matanya yang tajam. Tetapi musuh kian bertambah banyak juga, mereka hendak menyeberang yang menginjak tubuhnya untuk mencapai Rasulullah.

Sekarang marilah kita perhatikan saksi mata, yang akan menceritakan saat-saat terakhir kapahlawanan besar Mush’ab bin Umar.

Berkata Ibnu Sa’ad, “Diceritakan kepada kami oleh Ibrahim bin Muhammad bin Syurahbil al-‘Abdari dari bapaknya, ia berkata :

“Mush’ab bin Umair adalah pembawa bendera di Perang Uhud. Tatkala barisan Kaum Muslimin pecah, Mush’ab bertahan pada kedudukannya. Datanglah seseorang musuh berkuda, Ibnu Qumaiah namanya, lalu menebas tangan-nya hingga putus, sementara Mush’ab mengucapkan “Muhammad itu tiada lain hanyalah seorang Rasul” Maka dipegangnya bendera dengan tangan kirinya sambil membungkuk melindunginya. Musuhpun menebas tangan kirinya itu hingga putus pula. Mush’ab membungkuk ke arah bendera, lalu dengan kedua pangkal lengan meraih ke dada sambil mengucapkan, “Muhammad itu tiada lain hanyalah seorang Rasul, dan sebelumnya telah didahului oleh beberapa Rasul”. Lalu orang berkuda itu menyerangnya ketiga kali dengan tombak, dan menusukkannya hingga tombak itupun patah. Mush’ab pun gugur, dan bendera jatuh”.

Gugurlah Mush’ab dan jatuhlah bendera. ia gugur sebagai bintang dan mahkota para syuhada. Dan hal itu dialaminya setelah dengan keberanian luar biasa mengarungi kancah pengorbanan dan keimanan. Disaat itu Mush’ab berpendapat bahwa sekiranya ia gugur, tentulah jalan para pembunuh akan terbuka lebar menuju Rasulullah tanpa ada pembela yang akan mempertahankannya. Demi cintanya yang tiada terbatas kepada Rasulullah tanpa ada pembela yang akan mempertahankannya. Demi cintanya yang tiada terbatas kepada Rasulullah dan cemas memikirkan nasibnya nanti, ketika ia akan pergi berlalu, setiap kali pedang jatuh menerbangkan sebelah tangannya, dihiburnya dirinya dengan ucapan, “Muhammad itu tiada lain hanyalah seorang Rasul, dan sebelumnya telah didahului oleh beberapa Rasul”.

Kalimat yang kemudian dikukuhkan sebagai wahyu ini selalu diulang dan dibacanya sampai selesai, hingga akhirnya menjadi ayat Al-Quran yang selalu dibaca orang.

—oo—

Setelah pertempuran usai, ditemukanlah jasad pahlawan ulung yang syahid itu terbaring dengan wajah menelungkup ke tanah digenangi darahnya yang mulia. Dan seolah-olah tubuh yang telah kaku itu masih takut menyaksikan bila Rasulullah ditimpa bencana, maka disembunyikannya wajahnya agar tidak melihat peristiwa yang dikhawatirkan dan ditakutinya itu. Atau mungkin juga ia merasa malu karena telah gugur sebelum hatinya tenteram beroleh kepastian akan keselamatan Rasulullah, dan sebelum ia selesai menunaikan tugasnya dalam membela dan mempertahankan Rasulullah sampai berhasil.

Wahai Mush’ab cukuplah bagimu Ar-Raman.
Namamu harum semerbak dalam kehidupan.

—oo—

Rasulullah bersama para sahabat datang meninjau medan pertempuran untuk menyampaikan perpisahan kepada para syuhada. Ketika sampai ditempat terbaringnya jasad Mush’ab, bercucuran dengan deras air matanya. Berkata Khabbah ibnul ‘Urrat:

“Kami hijrah di jalan Allah bersama Rasulullah saw dengan mengharap keridlaan-Nya, hingga pastilah sudah pahala di sisi Allah. Diantara kami ada yang telah berlalu sebelum menikmati pahalanya di dunia ini sedikitpun juga. Diantaranya ialah Mush’ab bin Umair yang tewas di perang Uhud. Tak sehelaipun kain untuk menutupinya selain burdah. Andainya ditaruh diatas kepalanya, terbukalah kedua belah kakinya. Sebaliknya bila ditutupkan ke kakinya, terbukalah kepalanya. Maka sabda Rasulullah saw, “Tutupkanlah ke bagian kepalanya, dan kakinya tutupilah dengan rumput idzkhir!

Betapapun luka pedih dan duka yang dalam menimpa Rasulullah karena gugur pamanda Hamzah dan dirusak tubuhnya oleh orang-orang musyrik demikian rupa, hingga bercucurlah air mata Nabi. Dan betapapun penuhnya medan laga dengan mayat para sahabat dan kawan-kawannya, yang masing-masing mereka baginya merupakan panji-panji ketulusan, kesucian dan cahaya. Betapa juga semua itu, tapi Rasulullah tak melewatkan berhenti sejenak dekat jasad dutanya yang pertama, untuk melepas dan mengeluarkan isi hatinya. Memang, Rasulullah berdiri di depan Mush’ab bin Umair dengan pandangan mata yang pendek bagai menyelubungi dengan kesetiaan dan kasih sayang, dibacakannya ayat :


Diantara orang-orang Mu’min terdapat pahlawan-pahlawan yang telah menepati janjinya dengan Allah.

(Q.S. 33. Al-Ahzab : 23)

Kemudian dengan mengeluh memandangi burdah yang digunakan untuk kain tutupnya, seraya bersabda :

Ketika di Mekah dulu, tak seorangpun aku lihat yang lebih halus pakaiannya dan lebih rapi rambutnya dari padamu. Tetapi sekarang ini, dengan rambutmu yang kusut masi, hanya dibalut sehelai burdah.

Setelah melayangkan pandang, pandangan sayu ke arah medan serta para syuhada kawan-kawan Mush’ab yang tergeletak diatanya, Rasulullah berseru :

Sungguh Rasulullah akan menjadi saksi nanti di hari qiamat, bahwa tuan-tuan semua adalah syuhada disisi Allah

Kemudian sambil berpaling ke arah sahabat yang masih hidup, sabdanya,

Hai manusia! Berziarahlah dan berkunjunglah kepada mereka, serta ucapkanlah salam ! Demi Allah yang menguasai nyawaku, tak seorang Muslimpun sampai hari qiamat yang memberi salam kepada mereka, pasti mereka akan membalasnya.

Salam atasmu wahai Mush’ab…….
Salam atasmu sekalian, wahai para syuhada….

Mash’ab bin Umair lebih mencintai Islam dari pada keluarganya. Dia meninggal dunia pada perang Uhud dan Rasulullah saw pun menangisi kepergiannya.

Saya akhiri kisah Mash’ab bin Umair ini dengan satu peristiwa ketika Rasulullah saw pulang dari Uhud memasuki Madinah. Beliau disambut oleh perempuan-perempuan yang menangisi kematian keluarga mereka. Di antaranya ialah Zainab binti Jahasy. Begitu Rasulullah saw melihat Zainab, ia berkata, “Bersabarlah engkau Zainab.” Zainab ber-tanya, “Siapa yang meninggal itu, Ya Rasulullah?” “Saudaramu” jawab Rasul. “Inallilâhi wa inna ilayhi râji’ûn. Berbahagialah dengan syahadah yang telah dicapainya” jawab Zainab. Kemudian Rasulullah kembali berkata, “Bersabarlah engkau.” “Untuk siapa, Ya Rasulullah?” tanya Zainab. “Untuk Hamzah bin Abdul Muthalib,” jawab Rasul. Kembali Zainab berkata, “Innalillâhi wa inna ilayhi râji’ûn. Berbahagialah dengan syahadah yang telah dicapainya” Untuk ketiga kalinya, Rasulullah saw masih berkata, “Bersabarlah engkau, Hai Zainab” “Untuk siapa, Ya Rasulullah?” Zainab bertanya cemas. Rasul menjawab, “Untuk suamimu, Mash’ab bin Umair.” Barulah Zainab berteriak, “Duhai derita, duhai kesedihan!”

Ketika Mash’ab meninggal, dia masih memakai pakaiannya yang compang-camping itu. Rasulullah saw menangis dan berkata di hadapan jenazah Mash’ab, “Semoga Allah menyayangimu, Hai Mash’ab bin Umair. Aku sudah melihatmu di Mekkah dulu. Dan aku tak pernah melihat orang yang pakaiannya sebagus pakaian kamu. Yang kesenangannya sebaik kamu. Tapi sekarang, engkau dalam keadaan compang-camping dan tertutup debu”.
Rasulullah saw lalu menguburkan-nya. Saudara Mash’ab, Abu Rum, turun di kuburannya. Begitu juga Amir bin Rabiah Al-Anzi.

Rasulullah saw mendo’akan Mash’ab bin Umair. Berkenaan dengan Mash’ab, turun ayat Al-Qur’an Surat Al-Ahzab ayat 23, “Di antara orang-orang yang beriman itu ada orang yang membenarkan janji yang sudah mereka berikan kepada Allah”.

Itulah Mash’ab bin Umair, yang mendahulukan kesetiaan kepada Islam di atas kesetiaan kepada kelompoknya, kepada keluarganya, dan kepada suku bangsanya. Mash’ab bin Umair adalah contoh orang yang mendahulukan Islam dengan keramahan, dengan akhlak yang baik, dan dengan senyuman.

Dialah orang yang membawa Islam dengan Bunga Mawar, tapi tidak dengan durinya. Sementara banyak orang yang menyebarkan Mawar, tidak dengan menyebar-kan harumnya, melainkan durinya. Kalau kita sebarkan Islam dengan duri, kita akan banyak menyakiti orang. Tapi kalau kita sebarkan Islam dengan harumnya, Insya Allah, kita akan menarik mereka kepada Islam.

perang mu'tah

Hujr ibn Adi

Hujr ibn Adi (Arabicحجر بن عدي ‎) (d.660) was a supporter of Ali ibn Abi talib,
Aksi teror terhadap umat Islam dijalankan terhadap mereka yang tidak memberikan konsensus atas otoritas politis Muawiyah. Teror dilakukan secara terorganisir melalui jaringan aparatur pemerintahan dan pejabat-pejabat gubernur di beberapa wilayah kekuasaannya. Teror ini  dilakukan dengan cara intimidasi, pemenjaraan, pembunuhan hingga peperangan.
.
Sementara pembunuhan tanpa alasan yang sah, dalam Islam memang merupakan kejahatan fatal, sebagaimana dalam ayat QS: 5;32 oleh karena itu Kami tetapkan (suatu hukum) bagi Bani Israil, bahwa: Barangsiapa yang membunuh seorang manusia, bukan karena orang itu (membunuh) orang lain atau bukan karena membuat kerusakan dimuka bumi, Maka seakan-akan Dia telah membunuh manusia seluruhnya dan Barangsiapa yang memelihara kehidupan .seorang manusia, Maka seolah-olah Dia telah memelihara kehidupan manusia semuanya. dan Sesungguhnya telah datang kepada mereka Rasul-rasul Kami dengan (membawa) keterangan-keterangan yang jelas, kemudian banyak diantara mereka sesudah itu  sungguh sungguh melampaui batas dalam berbuat kerusakan dimuka bumi.
.
Seperti kebanyakan penguasa otoriter, maka dinasti muawiyah pun membutuhkan pemerintahan yang kuat. Untuk tujuan ini maka umat Islam dipaksa untuk mendukung, menyokong dan jika perlu memuja otoritas muawiyah. Disisi lain, terhadap rakyat dipaksa untuk membantu menyingkirkan, mendiskreditkan dan menjatuhkan siapapun yang mengganggu otoritas muawiyah. Dalam sejarah disebutkan bahwa telah terjadi propaganda anti Imam Ali as. Dengan melakukan penghujatan dalam tiap akhir mimbar jum’at di masjid-masjid dalam wilayah kekuasaan mu’awiyah.
.
Salah satu skandal pembunuhan tokoh penting – terhadap sahabat nabi yang sangat dihormati – adalah pembunuhan terhadap Hujr ibn Adi dan para pengikutnya. Latar belakang pembunuhan tersebut adalah suatu upaya untuk menyingkirkan pengaruh Imam Ali as. Dan pengikutnya (syi’ah Ali), agar “stabilitas” pemerintahan dapat terkendali. Metode represif dalam pengendalian stabilitas tersebut adalah untuk menciptakan ketakutan-ketakutan dan membungkam kelompok-kelompok oposisi.
.
Hujr bin Adi bin Jabalah Al-Kindi adalah seorang sahabat yang emberani. Ia pernah menjadi utusan Rasulullah SAW. dan terjun dalam Perang Qadisiyah. Ia dibunuh bersama sahabat-sahabatnya pada tahun 51 H. (Al-‘Alam, II/169)Disebutkan ketika Hujr akan dibunuh, ia berkata, “Biarkanlah aku berwudhu.”
.
Mereka menjawab, “Berwudhulah.”
.

Kemudia ia berkata, “Biarkanlah aku melaksanakan shalat dua rakaat.” Maka ia pun melaksanakan shalat dua rakaat pendek. Kemudian ia berkata, “Sekiranya aku tidak khawatir mereka akan mengatakan bahwa aku cemas karena akan mati, niscaya aku akan memanjangkan kedua rakaat shalat tersebut.” Ia melanjutkan, “Kedua rakaat tersebut telah didahului banyak shalat.”Kemudian mereka menggiringnya utnuk dibunuh. Mereka telah menggali kubur dan menyiapkan kafan untuknya dan sahabat-sahabatnya. Kemudia dikatakan kepdanya, “Engkau telah berkata bahwa engkau tidak gentar.”

Hujr menjawab, “Aku tidak akan gentar walaupun telah kulihat kubur yang telah tergali, kafan yang telah terbentang, dan pedang yang telah terhunus!

Kemudian seroang algojo maju ke hadapannya dan berkata, “Ulurkan lehermu!”

Ia menjawab, “Aku tidak akan membantu pembunuhan terhadap diriku.”

Maka algojo itu memenggal dan membunuhnya.

Pada hari ke 19 Ramadhan, Amirul Mukminin Imam Ali as sulit berbicara akibat racun yang bersarang dalam dirinya, dan beliau berkata, “Singkatkanlah pertanyaan-pertanyaan kalian.”

Hujur bin Adhi berkata, “Aku berdiri dan mengungkapkan syair kepada Imam Ali as,
Alangkah malangnya sang pemuka kaum takwa, ayah para manusia suci, sang Haidar yang suci (jiwanya) !

.
Orang kafir yang nista, pezina, terkutuk, fasik turunnya, celakalah yang telah membunuhnya.
Laknat Allah bagi yang berpaling dari kalian (wahai Ahlulbayt) dan yang berlepas diri dari kalian dengan laknat yang amat dahsyat

.
Karena kalian pada hari Mahsyar adalah bekalku, dan kalian Itrah Sang Nabi pemberi hidayah.

Mendengar syair Hujur ini, Imam Ali as menatapnya seraya berkata, “Bagaimanakah jadinya engkau nanti, yang pada saat itu, engkau akan dipaksa untuk berlepas diri dariku?”

Hujur menjawab,”Aku bersumpah demi Allah, seandainya aku dicincang dengan pedang lalu dibakar, aku tidak akan berpaling darimu.”

Imam Ali as berkata,”Semoga Allah memberimu balasan yang baik dan taufik dalam setiap kebaikan.”

Hujr bin Adi al Adbar adalah seorang sahabat Rasulullah (saww) dan salah satu pengikut sejati Imam Ali (as). Muawiyah Laknatullah telah memerintahkan pengikutnya (Laknatullah untuk mereka) membunuh Hujr bin Adi al Adbar. Hujr merupakan salah seorang sahabat Rasulullah (saww) yang tidak terima jika Imam Ali (as) dihina dengan cara apapun. Ibn Ziyad Laknatullah menyarankan kepada Muawiyah Laknatullah untuk menangkap Hujr dan sahabat-sahabatnya. Saat perjalanan ke Damaskus, Muawiyah Lakanatullah memerintahkan agar mereka dibunuh.

Ulama Mazhab Hanafi, Kamaluddin Umar ibn al Adim mencatat dalam Bughyat al Talib fi Tarikh Halab juz.2 hal.298 :

“Dia (Hujr bin Adi al Adbar) adalah penduduk Kufah, ia datang menemui Rasulullah (saww) sbg utusan (dr Kufah) dan dia salah seorang perawi dari (jalur) Ali bin Abi Thalib”

Hujr bin Adi al Adbar ikut serta dalam perang Jamal dan Sifin disisi Ali dan dia termasuk dalam syiah-nya. Ia telah dibunuh atas perintah Muawiyah di desa Mriaj Adra dekat Damaskus. Pada saat akan dibunuh ia meminta ; “Jgn singkirkan rantai ini setelah aku terbunuh, bgtu juga jgn bersihkan darahnya. Kami akan bertemu dg Muawiyah dan akan ku laporkan penentanganku terhadapnya” (Al Isaba, juz.1 halm.313 “Dzikr Hujr bin Adi”).

Aisyah berkata :

“Muawiyah..! kau telah membunuh Hujr dan sahabat-sahabatnya, Demi Allah, Rasul (saww) berkata kepadaku ; “Di lembah Adra tujuh orang akan terbunuh, yg membuat Allah dan seluruh (isi) langit murka”
(Tarikh, olh ibn Asakir, juz. 12 hal.227 “Dzikr Hujr bin Adi”)

“Hujr dan sahabat-sahabatnya ditangkap dan dibawa ke lembah Adra yang dekat dengan damaskus. Muawiyah memerintahkan bahwa hujr dan sahabat-sahabatnya hrs dibunuh dilembah tsb.”
(asad-ul-Ghaba, juz.1 hal. 244 “Dzikr Hujr bin Adi”)

Ibn Qutayba Dinwari (213-276 H) mencatat dalam karyanya yg masyhur “Al Ma’arif’”hal 76 :
Ia datang kepada Rasulullah saw sebagai utusan dan masuk Islam, ia hadir dalam perang Qadsiya, ia juga hadir dalam perang Jamal dan Sifin bersama Ali, lalu Muawiyah membunuhnya di Adra bersama kelompoknya”

Ulama mazhab Syafi’i, Allamah Hibatullah Lalkai (w.418) mencatat dalam “Syarh Usul Itiqad Ahlu Sunnah” Juz. 7 hal. 18 :
“Apa yang telah diriwayatkan mengenai karamah Hujr bin Adi atau Qais Makhshus seorang sahabat Rasulullah (saw)”

Imam Ali (as) bicara mengenai Hujr bin Adi :

Tercatat bahwa Imam Ali meramalkan terbunuhnya Hujr, hal ini oleh Allamah Muttaqi al Hindi dicatat dalam “Kanzul-Ummal” :
(Imam) Ali berkata “Hai orang-orang Kufah..! tujuh orang terbaik di antara kalian akan terbunuh, perumpamaan mereka sama dengan orang beriman di lembah”. Hujr bin Adi al Adbar dan sahabat-sahabatnya berada diantara mereka, dan mereka berasal dari Kufah, Muawiyah membunuh mereka di Adra perbatasan Damaskus”
(Kanzul Umal, Juz. 13 hal.531 riwayat 36530)

Pernah juga Aisyah bertanya kepada Muawiyah, (Kanzul Ummal juz.13 hal.556 riwayat 37510) :
Abi al Aswad meriwayatkan bahwa Muawiyah menemui Aisyah, dan Aisyah bertanya kepadanya ;
“Mengapa kau bunuh orang-orang Adra” (mksdnya Hujr dan sahabatnya).
Muawiyah menjawab : “Wahai Umul Mukminin, Aku melihat bahwa kematian mereka lebih baik untuk umat dan hidupnya mereka akan membawa kerugian umat”
Ia (Aisyah) berkata : “Aku mendengar Rasulullah (saww) berkata : “Beberapa orang akan terbunuh di Adra, Allah dan penduduk surga akan murka karena hal itu”

Untuk para Nashibi (wahabi) Muawiyah adalah orang yang mulia, mereka menyanjung Muawiyah dan mengatakan dia adalah Khalifah Muslim, menyebut “Radhiallahu Anhu” setelah menyebut namanya…!

Sejarah dipaparkan sangat jelas bahwa Muawiyah telah membuat Allah Murka, bukan hanya dalam kasus yang ini, ia adalah pembenci Ahlul Bait (as) yang masuk dalam al Ahzab 33. Tidak diragukan lagi bahwa Muawiyah adalah orang yang pantas dilaknat..!

Dalam Al Bidayah wal Nihayah juz. 8 hal.55 disebutkan bahwa :
“Ibn Asakir mencatat bahwa Hujr datang kepada Rasulullah (saw) dan mendengar (hadis) dari Ali, ammar, Syarajil bin Marat yang dikenal dengan Syarjil bin Marat”

Al Hakim dalam Mustadrak membuat bab khusus tentang Hujr bin Adi (ra), “Keutamaan Hujr bin Adi (ra) dan Ia seorang sahabat Muhammad saw (Manaqib Hujr bin Adi wa huwa asahab Muhammad” (Al Mustadrak Sahihain Juz.3 hal.468)

Jika orang berdalih bahwa Muawiyah adalah “sahabat” Rasul (saww) dan oleh karenanya ia tidak boleh dilaknat, siapapun yang mengatakan hal tersebut, lihatlah bahwa Muawiyah adalah pembunuh sahabat Rasulullah (saww) yang sekaligus pengikut Imam Ali (as), maka cukup bagi kami bahwa murka Allah kepada Muawiyah membebaskan kami untuk melaknat orang terkutuk ini.

“Sesungguhnya orang-orang yang menyimpan apa yang Kami turunkan berupa keterangan-keterangan dan petunjuk, setelah Kami menerangkannya kepada manusia dalam Al Kitab, mereka itu dilaknat oleh Allah dan dilaknat oleh semua makhluk yang dapat melaknat. Kecuali mereka yang telah bertaubat dan melakukan perbaikan dan menerangkan kebenaran, mereka itu Akulah Yang Maha menerima taubat lagi Maha Penyayang.”(Al-Baqarah ;159-160)

Demi Allah, saya lebih suka melewatkan suatu malam dalam jaga di atas duri-duri as-sa’dân (tumbuhan yang mempunyai duri-duri lancip) atau digiring dalam keadaan terbelenggu sebagai tawanan daripada menemui Allah dan Rasul-Nya di Hari Pengadilan sebagai penindas terhadap seseorang atau sebagai penyerobot (koruptor) sesuatu dari kekayaan dunia. Dan bagaimana saya dapat menindas sesorang demi (suatu kehidupan) yang begerak cepat ke arah kehancuran dan akan tinggal di bawah bumi untuk waktu lama.

Demi Allah, saya sungguh melihat (saudara saya) ‘Aqîl jatuh dalam kemiskinan dan ia meminta kepada saya satu sha’ (seberat kka-kira 3 kg) (dari bagian) gandum Anda, dan saya pun melihat anak-anaknya dengan rambut kusut dan wajah berdebu karena kelaparan, seakan-akan wajah mereka dihitamkan oleh nila. la datang kepada saya beberapa kali dan mengulangi permohonannya berkali-kali. Saya mendengarkannya dan ia berpikir seakan-akan saya mau menjual iman saya kepadanya dan mengikuti langkahnya dengan meninggalkan jalan saya sendiri. Kemudian saya (hanya) memanaskan sepotong besi dan mendekatkannya ke tubuhnya supaya ia boleh mengambil suatu pelajaran dari hal itu, lalu ia menangis sebagai seseorang dalam keadaan sakit yang berkepanjangan menangis karena kesakitan dan ia sudah hampir terbakar dengan besi panas itu. Kemudian saya berkata kepadanya, “Perempuan-perempuan berkabung boleh berkabung atas Anda, wahai ‘Aqîl. Apakah Anda menangis karena besi (panas) ini yang telah dibuat oleh seorang manusia sebagai main-main, sementara Anda mendorong saya ke arah api yang dipersiapkan Allah Yang Mahakuasa untuk (perwujudan) kemurkaan-Nya? Haruskah Anda menangis karena sakit tetapi saya tak boleh menangis karena api?

Suatu kejadian yang lebih aneh lagi dari ini ialah seorang lelaki [Al-Asy’ats ibn Qais] datang kepada kami di malam hari dengan botol tertutup yang penuh dengan pasta madu [sesuatu yg mahal], tetapi saya tidak menyukainya, seakan itu adalah liur atau muntah ular. Saya tanyakan kepadanya apakah itu suatu ganjaran, atau zakat atau sedekah, karena hal-hal ini terlarang bagi kami para anggota keluarga Nabi. la katakan hal itu bukan ini dan bukan itu melainkan suatu hadiah. Kemudian saya berkata, “Perempuan tak beranak boleh menangisi Anda. Apakah Anda datang untuk menyelewengkan saya dari agama Allah, atau apakah Anda gila, ataukah Anda telah ditaklukkan oleh suatu jin, atau apakah Anda berbicara tanpa makna?”

Demi Allah, sekalipun saya diberi semua wilayah tujuh (lapis langit) dengan segala yang ada di bawahnya agar saya melanggar perintah Allah dengan sekadar merebut sebutir gandum murahan dari seekor semut, saya tidak akan melakukannya. Bagi saya dunia Anda lebih enteng dari daun di mulut belalang yang sedang mengunyahnya. Apa hubungan ‘Ali dengan hadiah yang akan lewat dan kesenangan yang tidak akan langgeng? Kami memohon perlindungan Allah dari tergelincimya kebijaksanaan dan jahatnya kekeliruan, dan dari Dia kami mengharap pertolongan. •

Nahjul Balaghah Khotbah 222

Muawiyah Membunuh Sahabat Nabi Hujr bin Adi

Di antara salah satu penyimpangan yang dilakukan Muawiyah adalah perbuatannya yang membunuh salah seorang Sahabat Nabi yaitu Hujr bin Adiy Al Kindi RA. Hujr bin Adi adalah sahabat Nabi yang setia kepada Imam Ali AS, beliau bersama Imam Ali baik dalam perang Jamal maupun perang Shiffin. Para Ahli sejarah dan biografi rijal menyebutkan bahwa Hujr bin Adi dan para sahabatnya diperintahkan oleh Muawiyah untuk dieksekusi di desa Azra’ salah satu wilayah di Syam.

Ibnu Hajar menyebutkan biografi Hujr bin Adi dalam kitabnya Al Ishabah Fi Tamyiz As Shahabah 2/37 no 1631. Ibnu Abdil Barr dalam kitabnya Al Isti’ab 1/329 dan Ibnu Atsir dalam Usud Al Ghabah 1/565 mengatakan bahwa Hujr bin Adi salah seorang sahabat Nabi yang utama. Ibnu Atsir berkata dalam biografi Hujr

وشهد القادسية وكان من فضلاء الصحابة

Dia ikut dalam perang Qadisiyah dan dia salah seorang dari sahabat Nabi yang utama.

Selain itu Ibnu Atsir juga berkata tentang Hujr

فأنزل هو وأصحابه عذراء وهي قرية عند دمشق فأمر معاوية بقتلهم

Dia dan sahabatnya sampai di Adzra’ sebuah desa di Damasykus dan Muawiyah memerintahkan untuk membunuh mereka.

Al Hakim dalam Al Mustadrak 3/468 menuliskan Hujr dalam kitab Ma’rifat As Shahabah dengan judul

ذكر مناقب حجر بن عدي رضى الله تعالى عنه

وهو راهب أصحاب محمد صلى الله عليه وسلم

Keutamaan Hujr bin Adi Radiallahuta’ala anhu dan dia rahib sahabat Muhammad Shalallahualaihi wassalam.

Adz Dzahabi dalam Siyar A’lam An Nubala 3/463 menyebutkan biografi Hujr bin Adi dan ia berkata “lahu sahabah” yang artinya dia seorang Sahabat Nabi SAW. Adz Dzahabi juga memasukkan nama Hujr bin Adi dalam kitabnya Tajrid Asma As Shahabah 1/123 no 1264 dan berkata Adz Dzahabi dalam Tarikh Al Islam 4/33

حجر بن عدي حجر الخير. له وفادة على النبي صلى الله عليه وسلم فأسلم

Hujr bin Adiy Hujr Al khayr dia utusan yang datang kepada Nabi SAW dan memeluk islam.

Khairuddin Az Zarkali dalam kitabnya Al ‘Alam 2/169 menyebutkan biografi Hujr bin Ady

حجر بن عدي بن جبلة الكندي  ويسمى حجر الخير  صحابي شجاع  من المقدمين  وفد على رسول الله صلى الله عليه وسلم وشهد القادسية  ثم كان من أصحاب علي وشهد معه وقعتي الجمل وصفين

Hujr bin Ady bin Jabalah Al Kindi Hujr Al Khayr seorang Sahabat yang gagah berani dari golongan terdahulu. Dia utusan yang datang kepada Nabi SAW ikut dalam perang Qadisiyah dan dia juga sahabat Ali berada di sisinya pada saat perang  Jamal dan Shiffin.

Az Zarkali juga berkata

فأمر معاوية بقتله في مرج عذراء ( من قرى دمشق ) مع أصحاب

Muawiyah memerintahkan membunuhnya di Azra’ (suatu desa di damasykus) bersama para sahabatnya.

Ibnu Qutaibah Al Dinawari dalam kitabnya Al Ma’arif hal 148 menyebutkan biografi Hujr bin Ady

حجر بن عدي رضي الله تعالى عنه

هو الذي قتله معاوية ويكنى أبا عبد الرحمن وكان وفد إلى النبي صلى الله عليه وسلم وأسلم وشهد القادسية وشهد الجمل وصفين مع علي، فقتله معاوية بمرج غدراء مع عدة

Hujr bin Adiy Radiallahuta’ala anhu, dia dibunuh oleh Muawiyah. Kuniyahnya Abu Abdurrahman, dia seorang utusan yang datang kepada Nabi SAW dan memeluk islam. Ikut dalam perang Qadisiyah, mengikuti perang Jamal dan Shiffin bersama Ali, Muawiyah membunuhnya di Azra’ bersama beberapa sahabatnya.

perang mu'tah

Setelah gugur syahidnya Jakfar bin Abi Thalib dalam perang Mu’tah, Rasulullah Saw memerintahkan putri beliau Sayidah Fatimah as untuk menyiapkan makanan bagi keluarga Jakfar dan memberikannya kepada mereka. Sejak masa itu muncul tradisi dalam umat Muslim untuk membawa makanan kepada saudara Muslim yang sedang berkabung
.
Perang Mu’tah terjadi pada tanggal enam Jumadil Awal tahun ketujuh Hijrah dan dalam perang tersebut tiga ksatria Islam yaitu, Ja’far bin Abi Thalib, Zaib bin Haritsah, dan Abdullah bin Rawahah, gugur syahid
.
Perang Mu’tah meletus setelah Harits bin Amir Azdi yang membawa surat dari Rasulullah untuk Kaisar Romawi, ditangkap atas instruksi panglima pasukan Romawi di wilayah Mu’tah. Utusan Rasulullah Saw itu diikat dan dipenggal
.
Mendengar berita itu Rasulullah Saw sangat sedih dan mengirim pasukan menuju Mu’tah.
Dalam perang tersebut, jumlah pasukan Muslim mencapai 3.000 orang sementara pasukan kufar mencapai 100 ribu orang. Rasulullah Saw dan Imam Ali as tidak ikut dalam perang tersebut. Akan tetapi Rasulullah menunjukk Jakfar, Zaid, dan Abdullah sebagai para panglima pasukan Islam. Ketiga ksatria besar Islam itu ditunjuk sebagai panglima jika salah satu di antara mereka gugur syahid
.
Akan tetapi dalam perang tersebut, ketiga panglima yang ditunjuk oleh Rasulullah Saw gugur syahid. Pertama, saudara Imam Ali as yaitu Jakfar bin Abi Thalib yang terjun ke medan perang. Dua tangannya diputus. Meski telah menderita luka-luka akan tetapi musuh tidak berani memenggal kepala Jakfar. Akhirnya mereka mengangkat badannya dengan menggunakan tombak
.
Ketika itu, Rasulullah Saw yang berada di Madinah, pergi ke atas mimbar dan menceritakan kisah Jakfar kepada masyarakat. Kemudian Rasulullah menengadahkan kepala menuju langit dan mengangat tangan mendoakan Jakfar bin Abi Thalib. Allah Swt telah memberikan dua sayap kepada Jakfar dan terbang menuju sorga bersama para malaikat
.
Setelah gugunya ketiga panglima yang ditunjuk oleh Rasulullah Saw, jenazah mereka disemayamkan dalam satu makam.  Rasulullah Saw sangat bersedih dan menangisi kepergian Ja’far bin Abi Thalib dan memerintahkan untuk mengantarkan makanan ke rumah keluarga Ja’far selama tiga hari
.
Asma’ binti Umais, istri Jakfar bin Abi Thalib dalam hal ini mengatakan, “Pada hari ketika Jakfar gugur syahid di Mu’tah, aku sedang membuat roti di rumah dan memandikan anak-anakku. Tiba-tiba Rasulullah datang ke rumahku dan berkata; mana anak-anakku? Kemudian aku mengantar anak-anakku kepada Rasulullah, beliau memeluk dan mengelus-elus kepala mereka
.
Aku berkata kepada Nabi, “Wahai Rasulullah, Anda seperti sedang mengelus-elus kepala anak yatim. Setelah itu Rasulullah menitikkan air mata dan berkata, “Jakfar telah gugur syahid!”
.
Asma’ kemudian berkata, “Setelah itu aku menangis dan para perempuan mengelilingiku dan menangis. Rasulullah berdiri dan pulang serta menyuruh Fatimah sa memasak makanan untuk keluarga Jakfar dan memberikan kepada mereka. Rasulullah juga memerintahkan kepada para istri beliau untuk pergi ke rumah Jakfar dan ikut dalam acara berkabung mereka
.
Dalam riwayat disebutkan bahwa hal itu diulangi selama tiga hari dan oleh karena itu hal tersebut menjadi budaya bagi umat Islam hingga setelah Rasulullah Saw wafat.
.

Pertempuran Mu’tah

Pertempuran Mu’tah
Bagian dari the Perang Arab-Bizantium
Tanggal 629
Lokasi Dekat KarakYordania
Hasil kemenangan Muslim (menurut Ibnu Katsir), kemenangan Bizantium[1]
atau imbang[2][3]
Pihak yang terlibat
Arab Muslim
Komandan
Zaid bin Haritsah,
Ja’far bin Abu Thalib,
Abdullah bin Rawahah
Kekuatan
3,000 (Ibnu Qayyim danIbnu Hajar)[4][5][5][6]
Jumlah korban
12 (sumber Muslim, mungkin lebih)[5]

.

Pertempuran Mu’tah (bahasa Arabمعركة مؤتة , غزوة مؤتة) terjadi pada 629 M atau 5 Jumadil Awal 8 Hijriah[5]), dekat kampung yang bernama Mu’tah, di sebelah timur Sungai Yordan dan Al Karak, antara pasukan Khulafaur Rasyidin yang dikirim oleh Nabi Muhammad dan tentara Kekaisaran Romawi Timur(Bashra)

.

Latar belakang

Setelah Perjanjian Hudaibiyyah disepakati, Rasullulah mengirimkan surat-surat dakwah sekaligus berdiplomasi kepada para penguasa negeri yg berbatasan dengan jazirah arab, termasuk kepada Heraklius. Pada Tahun 7 hijriah atau 628 AD, Rasulullah menugaskan al-Harits bin ‘Umair untuk mengirimkan surat dakwah kepada Gubernur Syam(Irak) bernama Hanits bin Abi Syamr Al-Ghassani yg baru diangkat oleh Kekaisaran Romawi. Dalam Perjalanan, di daerah sekitar Mut’ah, al-Harits bin ‘Umair dicegat dan dibunuh oleh penguasa setempat bernama Syurahbil bin ‘Amr al-Ghassani pemimpin dari suku Ghassaniyah (Pada waktu itu yang berkuasa di wilayah Palestina dan sekitarnya).[7] [8][9][10] Dan Pada tahun yg sama Utusan Rasulullah pada Banu Banu Sulayman dan Dhat al Talh daerah disekitar negeri Syam(Irak) juga dibunuh oleh penguasa sekitar.[11] Sebelumnya, tidak pernah seorang utusan dari Rasulullah shalallahu ‘alaihi wassalam dibunuh dalam misinya.

Sedangkan menurut sumber-sumber Barat modern, pertempuran ini adalah upaya penaklukan yang gagal terhadap bangsa Arab di sebelah timur Sungai Jordan.[12]. Tentunya hal ini dikritisi sebab tidak mampu menjelaskan secara logis latar belakang pertempuran, antara pasukan muslim yg bahkan belum mempersatukan jazirah Arab dan belum menguasai Mekah yg berani menentang kekuasaan bangsa adidaya Romawi didaerah utara yg sangat jauh dari Madinah.

Pertempuran

Sebelum pasukan islam berangkat untuk menegakkan panji La ilaha Illallah, Rasulullah shalallahu ‘alaihi wassalam telah menunjuk tiga orang sahabat sekaligus mengemban amanah komanda secara bergantian bila komandan sebelumnya gugur dalam tugas di medan peperangan hingga mengakibatkan tidak dapat meneruskan kepemimpinan. Sebuah keputusan yang belum pernah beliau lakukan sebelumnya. Mereka itu adalah Ja’far bin Abi ThalibZaid bin Haritsah (berasal dari kaum muhajirin) dan seorang sahabat dari Anshar, Abdullah bin Rawahah, penyair Rasulullah shalallahu ‘alaihi wassalam.[13]

Singkatnya, pasukan islam yang berjumlah 3000 personel diberangkatkan. Ketika mereka sampai di daerah Ma’an, terdengar berita bahwa Heraklius mempersiapkan 100 ribu pasukannya. Selain itu, kaum Nasrani dari beberapa suku Arab pun telah siap dengan jumlah yang sama. Mendengar kabar yang demikian, sebagian sahabat radhiyallahu ‘anhum mengusulkan supaya meminta bantuan pasukan kepada Rasulullah atau beliau memutuskan suatu perintah.

‘Abdullah bin Rawanah radhiyallahu ‘anhu lantas mengobarkan semangat juang para sahabat radhiyallahu ‘anhum pada waktu itu dengan perkataannya , “Demi Allah, sesungguhnya perkata yang kalian tidak sukai ini adalah perkata yang kamu keluar mencarinya, yaitu syahadah (gugur dimedan perang dijalan Allah Azza wa Jalla). Kita itu tidak berjuang karena karena jumlah pasukan atau kekuatan. Kita berjuang untuk agama ini yang Allah Azza wa Jalla telah memuliakan kita dengannya. Bergeraklah. Hanya ada salah satu dari dua kebaikan : kemenangan atau gugur (syahid) di medan perang.”

Orang-orang menanggapi dengan berkata, “ Demi Allah, Ibnu Rawanah berkata benar”.

Zaid bin Haritsah radhiyallahu ‘anhu, panglima pertama yang ditunjuk Rasulullah shalallahu ‘alaihi wassalam, kemudian membawa pasukan ke wilayah Mu’tah. Dua pasukan berhadapan dengan sengit. Komandan pertama ini menebasi anak panah-anak panah pasukan musuh sampai akhirnay tewas terbunuh di jalan Allah Azza wa Jalla.

Bendera pun beralih ke tangan Ja’far bin Abi Thalib radhiyallahu ‘anhu. Sepupu Rasulullah shalallahu ‘alaihi wassalam ini berperang sampai tangan kanannya putus. Bendera beliau pegangi dengan tangan kiri, dan akhirnya putus juga oleh tangan musuh. Dalam kondisi demikian, semangat beliau tak mengenal surut, saat tetap berusaha mempertahankan bendera dengan cara memeluknya sampai beliau gugur oleh senjata lawan. Berdasarkan keterangan Ibnu ‘Umar radhiyallahu ‘anhu, salah seorang saksi mata yang ikut serta dalam perang itu, terdapat tidakkurang 90 luka di bagian tubuh depan beliau baik akibat tusukan pedang dan maupun anak panah.[14]

Gilirang ‘Abdullah bin Rawanah radhiyallahu ‘anhu pun datang. Setelah menerjang musuh, ajal pun memjemput beliau di medan peperangan.

Tsabit bin Arqam radhiyallahu ‘anhu mengambil bendera yang telah tak bertuan itu dan berteriak memanggil para Sahabat Nabi agar menentukan pengganti yang memimpin kaum muslimin. Maka, pilihan mereka jatuh pada Khalid bin Walid radhiyallahu ‘anhu. Dengan kecerdikan dan kecemerlangan siasat dan strategi – setelah taufik dari Allah Azza wa Jalla – kaum muslimin berhasil memukul Romawi hingga mengalami kerugian yang banyak.

Setelah pertempuran

Menyaksikan peperangan yang tidak seimbang antara kaum muslimin dengan kaum kuffar, yang merupakan pasukan aliansi antara kaum Nashara Romawi dan Nashara Arab, secara logis, kekalahan bakal di alami oleh para sahabat Rasulullah shalallahu ‘alaihi wassalam.

Ibnu Katsir rahimahullah mengungkapkan ketakjubannya terhadap kekuasaan Allah Azza wa Jalla melalui hasil peperangan yang berakhir dengan kemenangan kaum muslimin dengan berkata : “Ini kejadian yang menakjubkan sekali. Dua pasukan bertarung, saling bermusuhan dalam agama. Pihak pertama pasukan yang berjuang dijalan Allah Azza wa Jalla, dengan kekuatan 3000 orang. Dan pihak lainnya, pasukan kafir yang berjumlah 200 ribu pasukan. 100 ribu orang dari Romawi dan 100 ribu orang dari Nashara Arab. Mereka saling bertarung dan menyerang. Meski demikian sengitnya, hanya 12 orang yang terbunuh dari pasukan kaum muslimin. Padahal, jumlah korban tewas dari kaum musyirikin sangat banyak”.[15]

Allah Azza wa Jalla berfirman :

Orang-orang yang menyakini bahwa mereka akan menemui Allah berkata, “Berapa banyak terjadi golongan yang sedikit dapat mengalahkan golongan yang banyak dengan izin Allah? Dan Allah beserta orang-orang yang sabar”. (Al-Baqarah 2:249)

Para ulama sejarah tidak bersepakat pada satu kata mengenai jumlah syuhada Mu’tah. Namun, yang jelas jumlah mereka tidak banyak. Hanya berkisar pada angka belasan, menurut hitungan yang terbanyak. Padahal, peperangan Mu’tah sangat sengit. Ini dapat dibuktikan bahwa Khalid bin Walid rahimahullah menghabiskan 9 pucuk pedang dalam perang tersebut. Hanya satu pedang yang tersisa, hasil buatan Yaman.

Khalid rahimahullah berkata, “Telah patah Sembilan pedang ditanganku, tidak tersisa kecuali pedang buatan Yaman.[16]

Menurut Imam Ibnu Ishaq seorang Imam dalam ilmu sejarah Islam, syuhada perang Mu’tah hanya berjumlah 8 Sahabat saja. Secara terperinci yaitu Ja’far bin Abi Thalib, dan mantan budak Rasulullah shalallahu ‘alaihi wassalam Zaid bin Haritsah al-Kalbi, Mas’ud bin al-Aswad bin Haritsah bin Nadhlah al-‘Adawi, Wahb bin Sa’d bin Abi Sarh radhiyallahu ‘anhum.

Sementara dari kalangan kaum anshar, ‘Abdullah bin Rawahah, ‘Abbad bin Qais al-Khozarjayyan, al-Harits bin an-Nu’man bin Isaf bin Nadhlah an-Najjari, Suraqah bin ‘Amr bin Athiyyah bin Khansa al-Mazini radhiyallahu ‘anhum.

Di sisi lain, Imam Ibnu Hisyam rahimahullah dengan berlandaskan keterangan az-Zuhri rahimahullah, menambahkan empat nama dalam deretan Sahabat Nabi shalallahu ‘alaihi wassalam yang gugur di medan perang Mu’tah. Yakni, Abu Kulaib dan Jabir. Dua orang ini saudara sekandung. Ditambah ‘Amr bin ‘Amir putra Sa’d bin Tsa’labah bi Malik bin Afsha. Mereka juga berasal dari kaum anshar. Dengan ini, jumlah syuhada bertambah menjadi 12 jiwa.[17]

Referensi

Catatan kaki

  1. ^ F. Donner, The Early Islamic Conquests, p.105
  2. ^ Ibnu Ishaq dan Ibnu Hisyam melaporkan imbang untuk kedua belah pihak, baik Muslim maupun Romawi. Sedangkan Ibnu Katsir melaporkan kemenangan Muslim.
  3. ^ a b Muhammad Husayn HaykalThe Life of Muhammad (Allah’s peace and blessing be upon him), Diterjemahkan oleh Isma’il Razi A. al-Faruqi, 1976, American Trust Publications ISBN 0-89259-002-5
  4. ^ Ibn Qayyim Al-JawziyyaZad al-Ma’ad 2/155.
  5. ^ a b c d e Saif-ur-Rahman Mubarakpuri, ar-Raheeq al-Makhtoom, “The Sealed Nectar”, Islamic University of Medina, Dar-us-Salam publishers ISBN 1-59144-071-8
  6. ^ Ibnu HajarFath al-Bari 7/511.
  7. ^ http://www.dakwatuna.com/2008/peperangan-di-masa-rasulullah-bagian-4/
  8. ^ http://www.salaam.co.uk/books/show_comm_review.php?commreview_id=18
  9. ^ Kelengkapan Tarikh Edisi Lux Jilid 2 Oleh Moenawar Chalil, K.H. hal 483
  10. ^ Fathul Baari (9/368)
  11. ^ http://lsinsight.org/articles/2001/peace-war/ch3.htm
  12. ^ Buhl, F “Mu’ta”. Encyclopaedia of Islam Online Edition. Ed. P.J. Bearman, Th. Bianquis, C.E. Bosworth, E. van Donzel and W.P. Heinrichs. Brill Academic Publishers. ISSN 1573-3912.
  13. ^ Rasulullah shalallahu ‘alaihi wassalam bersabda : “Bila Zaid meninggal, makan (pemimpin kalian adalah) Ja’far. Jika Ja’far meninggal, maka (pemimpin kalian adalah) ‘Abdullah bin Rawanah (Hadits riwayat Imam Bukhari no.4260-4261)
  14. ^ Hadits riwayat Imam Bukhari no.4261
  15. ^ Lihat al-Bidayah wan Nihayah (4/214)
  16. ^ Hadits riwayat Imama Bukhari 4265-4266.
  17. ^ Menurut penulis as-Sirah ash-Shahihah (hal.468) jumlah Sahabat yang gugur 13 orang
.
perang mu'tah

Ketangguhan tiga panglima perang Mu’tah

Singkatnya, pasukan Islam yang berjumlah 3000 personel diberangkatkan. Ketika mereka sampai di daerah Ma’an, terdengar berita bahwa Heraklius mempersiapkan 100 ribu pasukannya. Selain itu, kaum Nasrani dari beberapa suku Arab pun telah siap dengan jumlah yang sama. Mendengar kabar demikian, sebagian sahabat mengusulkan supaya meminta bantuan pasukan kepada Rasulullah atau beliau memutuskan suatu perintah.

Abdullah bin Rawahah lantas mengobarkan semangat juang para Sahabat pada waktu itu dengan perkataannya, “Demi Allah, sesungguhnya perkara yang kalian tidak sukai ini adalah perkara yang kamu keluar mencarinya, yaitu syahadah (gugur di medan perang di jalan Allah Subhanahu wa Ta’ala). Kita itu tidak berjuang karena jumlah pasukan atau kekuatan. Kita berjuang untuk agama ini yang AllahSubhanahu wa Ta’ala telah memuliakan kita dengannya. Bergeraklah. Hanya ada salah satu dari dua kebaikan: kemenangan atau gugur (syahid) di medan perang.”

Orang-orang menanggapi dengan berkata, “Demi Allah, Ibnu Rawahah berkata benar.”

Zaid bin Haritsah, panglima pertama yang ditunjuk Rasulullah Shallallahu ‘alaihi wa sallam, kemudian membawa pasukan ke wilayah Mu’tah. Dua pasukan berhadapan dengan sengit. Komandan pertama ini menebasi anak panah-anak panah pasukan musuh sampai akhirnya tewas terbunuh di jalan AllahSubhanahu wa Ta’ala.

Bendera pun beralih ke tangan Ja’far bin Abi Thalib. Sepupu Rasulullah shallallahu ‘alaihi wa sallam ini berperang sampai tangan kanannya putus. Bendera beliau pegangi dengan tangan kiri, dan akhirnya putus juga oleh senjata musuh. Dalam kondisi demikian, semangat beliau tak mengenal surut, saat tetap berusaha mempertahankan bendera dengan cara memeluknya sampai beliau gugur oleh senjata lawab. Berdasarkan keterangan Ibnu Umar, salah seorang saksi mata yang ikut dalam perang itu, terdapat tidak kurang 90 luka di bagian tubuh depan beliau baik akibat tusukan pedang dan maupun anak panah.

Giliran Abdullah bin Rawahah pun datang. Setelah menerjang musuh, ajal pun menjemput beliau di medan peperangan.

Tsabit bin Arqam mengambil bendera yang telah tak bertuan itu dan berteriak memanggil para sahabat Nabi agar menentukan pengganti yang memimpun kaum muslimin. Maka, pilihan mereka jatuh pada Khalid bin Walid. Dengan kecerdikan dan kecemerlangan siasat dan strategi –setelah taufik dari AllahSubhanahu wa Ta’ala—kaum muslimin berhasil memukul Romawi hingga mengalami kerugian banyak.

Jumlah syuhada perang Mu’tah

Menyaksikan peperangan yang tidak seimbang antara kaum muslimin dengan kaum kuffar, yang merupakan pasukan aliansi antara kaum Nashara Romawi dan Nashara Arab, secara logis, kekalahan bakal dialami oleh para Sahabat Rasulullah Shallallahu ‘alaihi wa sallam.

Imam Ibnu katsir mengungkapkan ketakjubannya terhadap kekuasaan Allah Subhanahu wa Ta’alamelalui hasil peperangan yang berakhir dengan kemenangan kaum muslimin dengan berkata, “Ini kejadian yang menakjubkan sekali. Dua pasukan bertarung, saling bermusuhan dalam agama. Pihak pertama pasukan yang berjuang di jalan Allah Subhanahu wa Ta’ala, dengan kekuatan 3000 orang. Dan pihak lainnya, pasukan kafir yang berjumlah 200 ribu pasukan. 100 ribu orang dari Romawi dan 100 ribu orang dari Nashara Arab. Mereka saling bertarung dan menyerang. Meski demikian sengitnya, hanya 12 orang yang terbunuh dari pasukan kaum muslimin, padahal, jumlah korban tewas dari kaum musyirikin sangat banyak.” Allah Subhanahu wa Ta’ala berfirman:

“Orang-orang yang meyakini bahwa mereka akan menemui Allah berkata, “Berapa banyak terjadi golongan yang sedikit dapat mengalahkan golongan yang banyak dengan izin Allah? Dan Allah beserta orang-orang yang sabar.” (Q.S. Al-Baqarah: 249)

Para ulama sejarah tidak bersepakat pada satu kata mengenai jumlah syuhada Mu’tah. Namun, yang jelas jumlah mereka tidak banyak. Hanya berkisar pada angka belasan, menurut hitungan yang terbanyak. Padahal, peperangan Mu’tah sangat sengit. Ini dapat dibuktikan bahwa Khalid bin Walid menghabiskan 9 pucuk pedang dalam perang tersebut. Kesembilan pedang itu patah. Hanya satu pedang yang tersisa, hasil buatan Yaman.

Khalid berkata, “Telah patah sembilan pedang di tanganku. Tidak tersisa kecuali pedang buatan Yaman.” (HR. Al-Bukhari 4265-4266)

Menurut Imam Ibnu Ishaq – imam dalam ilmu sejarah Islam –, syuhada perang Mu’tah hanya berjumlah 8 sahabat saja. Secara terperinci, yaitu Ja’far bin Abi Thalib, dan mantan budak Rasulullah shallallahu ‘alaihi wa sallam Zaid bin Haritsah Al-Kalbi, Mas’ud bin Al-Aswad bin Haritsah bin Nadhlah Al-Adawi, Wahb bin Sa’d bin Abi Sarh.

Sementara dari kalangan kaum Anshar, Abdullah bin Rawahah, Abbad bin Qais Al-Khazarjayyan, Al-Harits bin an-Nu’man bin Isaf bin Nadhlah an-Najjari, Suraqah bin Amr bin Athiyyah bin Khansa Al-mazini.

Di sisi lain, Imam Ibnu Hisyam dengan berlandaskan keterangan Az-Zuhri, menambahkan empat nama dalam deretan Sahabat Nabi shallallahu ‘alaihi wa sallam yang gugur di medan perang Mu’tah. Yakni, Abu Kulaib dan Jabir. Dua orang ini saudara sekandung. Diitambah Amr bin Amir putra Sa’d bin Al-Harits bin Abbad bin Sa’d bin Amir bin Tsa’labah bin Malik bin Afsha. Mereka juga berasal dari kaum Anshar. Dengan ini, jumlah syuhada bertambah menjadi 12 jiwa.

Semoga Allah Subhanahu wa Ta’ala memudahkan kita untuk meneladani semangat juang mereka di jalan Allah Subhanahu wa Ta’ala. Meskipun kondisi berat lantaran jumlah personel yang sedikit, namun hal itu tidak mengendurkan langkah mereka untuk terus berjihad di jalan Allah Subhanahu wa Ta’ala.Wallahu a’lam.

.
Perang Mu’tah; Heroik, 3.000 VS 200.000 
PERTEMPURAN paling heroik dan dahsyat yang dialami umat Islam di era awal perkembangan Islam adalah saat mereka yang hanya berkekuatan 3000 orang melawan pasukan terkuat di muka bumi saat itu, Pasukan Romawi dengan kaisarnya Heraclius yang membawa pasukan sebanyak 200.000. Pasukan super besar tersebut merupakan pasukan aliansi antara kaum Nashara Romawi dan Nashara Arab sekitar dataran Syam, jajahan Romawi. Perang terjadi di daerah Mu’tah –sehingga sejarawan menyebutnya perang Mu’tah- (sekitar yordania sekarang), pada tanggal 5 Jumadil Awal tahun 8 H atau tahun 629 M
.
Latar Belakang
.
Penyebab perang Mu’tah ini bermula ketika Rasulullah Shallallâhu ‘alaihi wasallam mengirim utusan bernama al-Harits bin Umair al-‘Azdi yang akan dikirim ke penguasa Bashra. Di tengah perjalanan, utusan itu ditangkap Syurahbil bin ‘Amr al-Ghassani dari bani Gasshaniyah (daerah jajahan romawi) dan dibawa ke hadapan kaisar Romawi Heraclius. Setelah itu kepalanya dipenggal. Pelecehan dan pembunuhan utusan negara termasuk menyalahi aturan politik dunia. Membunuh utusan sama saja ajakan untuk berperang. Hal inilah yang membuat beliau marah.Mendengar utusan damainya dibunuh, Rasulullah Shallallâhu ‘alaihi wasallam sangat sedih. Setelah sebelumnya berunding dengan para Sahabat, lalu diutuslah pasukan muslimin untuk berangkat ke daerah Syam. Rasulullah Shallallâhu ‘alaihi wasallam sadar melawan penguasa Bushra berarti juga melawan pasukan Romawi yang notabene adalah pasukan terbesar dan terkuat di muka bumi ketika itu. Namun ini harus dilakukan karena bisa saja suatu saat pasukan lawan akan menyerang Madinah. Kelak pertempuran ini adalah awal dari pertempuran Arab – Bizantium
.

Rasulullah Shallallâhu ‘alaihi wasallam berkata “Pasukan ini dipimpin oleh Zaid bin Haritsah, bila ia gugur komando dipegang oleh Jakfar bin Abu Thalib, bila gugur pula panji diambil oleh Abdullah bin Rawahah –saat itu beliau meneteskan air mata- selanjutnya bendera itu dipegang oleh seorang ‘pedang Allah’ dan Akhirnya Allah Subhânahu wata‘âlâ memberikan kemenangan. (HR. al-Bukhari)

.

Peperangan yang Sengit

.

Kaum Muslimin bergerak meninggalkan Madinah. Musuh pun mendengar keberangkatan mereka. Dipersiapkanlah pasukan super besar guna menghadapi kekuatan kaum Muslimin. Heraclius mengerahkan lebih dari 100.000 tentara Romawi sedangkan Syurahbil bin ‘Amr mengerahkan 100.000 tentara yang terdiri dari kabilah Lakham, Juzdan, Qain dan Bahra‘. Kedua pasukan bergabung

.

Mendengar kekuatan musuh yang begitu besar, kaum Muslimin berhenti selama dua malam di daerah bernama Mu’an guna merundingkan apa langkah yang akan diambil. Beberapa orang berpendapat, “Sebaiknya kita menulis surat kepada Rasulullah Shallallâhu ‘alaihi wasallam, melaporkan kekuatan musuh. Mungkin beliau akan menambah kekuatan kita dengan pasukan yang lebih besar lagi, atau memerintahkan sesuatu yang harus kita lakukan.” Tetapi Abdullah bin Rawahah tidak menyetujui pendapat tersebut. Bahkan ia mengobarkan semangat pasukan dengan ucapan berapi-api:

.

“Demi Allah Subhânahu wata‘âlâ, sesungguhnya apa yang kalian tidak sukai ini adalah sesuatu yang kalian keluar mencarinya, yaitu syahid (gugur di medan perang). Kita tidak berperang karena jumlah pasukan atau besarnya kekuatan. Kita berjuang semata-mata untuk agama ini yang Allah Subhânahu wata‘âlâ telah memuliakan kita dengannya. Majulah! Hanya ada salah satu dari dua kebaikan; menang atau gugur (syahid) di medan perang.” Lalu mereka mengatakan, “ Demi Allah, Ibnu Rawahah berkata benar.”

.

Terjadilah perang di daerah Mu’tah (sekitar Yordania sekarang). Perang dimulai. Komandan pasukan, Zaid bin Haritsah bertempur heroik, membabat pedangnya kesana kemari, menghabisi pasukan Romawi. Perlawanannya harus terhenti setelah ia tersungkur dari kudanya karena kudanya berhasil di ditombak. Zaid gugur setelah ditebas pedang lawan.

.

Lalu komandan perang dipegang Jakfar bin Abu Thalib. Jakfar bertempur dengan gagah berani sambil memegang bendera pasukan. Tiba-tiba tangan kirinya putus tertebas pedang musuh. Lalu bendera dipegang tangan kanannya. Namun tangan kanannya pun ditebas. Dalam kondisi demikian, semangat beliau tidak surut, ia tetap berusaha mempertahankan bendera dengan cara memeluknya sampai beliau gugur oleh senjata lawan. Berdasarkan keterangan Ibnu Umar Radhiyallâhu ‘anhu, salah seorang saksi mata yang ikut serta dalam perang itu, terdapat tidak kurang 90 luka di bagian tubuh depan beliau akibat tusukan pedang dan anak panah.

.

Selanjutnya komando pasukan diambil alih oleh Abdullah bin Rawahah. Namun nasibnya pun sama, gugur sebagai syuhada. Tsabit bin Arqam Radhiyallâhu ‘anhu mengambil bendera yang tidak bertuan itu dan berteriak memanggil para Sahabat Nabi agar menentukan pengganti yang memimpin kaum muslimin. Maka, pilihan mereka jatuh pada Khalid bin Walid Radhiyallâhu ‘anhu yang terkenal sebagai seorang yang punya strategi perang yang handal. Ini adalah peperangan pertamanya, karena belum lama dia masuk Islam

.

Khalid bin Walid Radhiyallâhu ‘anhu sangat sadar, tidaklah mungkin menandingi pasukan sebesar pasukan Romawi tanpa siasat yang jitu. Ia lalu mengatur strategi, ditebarkan rasa takut ke diri musuh dengan selalu formasi pasukan setiap hari. Pasukan di barisan depan ditukar dibelakang, dan yang dibelakang berada didepan. Pasukan sayap kanan berganti posisi ke kiri begitupun sebaliknya. Tujuannya adalah agar pasukan romawi mengira pasukan muslimin mendapat bantuan tambahan pasukan baru

.

Khalid bin Walid memerintahkan beberapa kelompok prajurit kaum muslimin pada pagi harinya agar berjalan dari arah kejauhan menuju medan perang dengan menarik pelepah-pelepah pohon sehingga dari kejauhan terlihat seperti pasukan bantuan yg datang dengan membuat debu-debu berterbangan. Pasukan musuh yg menyaksikan peristiwa tersebut mengira bahwa pasukan muslim benar-benar mendapatkan bala bantuan. Mereka berpikir, bahwa kemarin dengan 3000 orang pasukan saja merasa kewalahan, apalagi jika datang pasukan bantuan. Karena itu, pasukan musuh merasa takut dan akhirnya mengundurkan diri dari medan pertempuran. Pasukan Islam lalu kembali ke Madinah, mereka tidak mengejar pasukan Romawi yang lari, karena dengan mundurnya pasukan Romawi berarti Islam sudah menang

.

Menang atau Imbang

.

Ibnu Ishaq dan Ibnu Hisyam menyebutkan bahwa pertempuran ini berakhir imbang. Hal karena kedua belah pasukan sama-sama menarik mundur pasukannya yang lebih dahulu dilakukan oleh Romawi. Sedangkan Ibnu Katsir menyebutkan bahwa dalam pertempuran ini kemenangan berada di tangan Muslim

.

Sebenarnya tanpa ada justifikasi kemenanganpun akan diketahui ada dipihak siapa. Keberanian pasukan yang hanya berjumlah 3.000 dengan gagah berani menghadapi dan dapat mengimbangi pasukan yang sangat besar dan bersenjata lebih canggih dan lengkap cukup menjadi bukti. Bahkan jika menghitung jumlah korban dalam perang itu siapapun akan langsung mengatakan bahwa umat islam menang. Mengingat korban dari pihak muslim hanya 12 orang, (Menurut riwayat Ibnu Ishaq 8 orang, sedang dalam kitab as-Sîrah ash-Shahîhah (hal.468) 13 orang) sedangkan pasukan Romawi tercatat sekitar 20.000 orang

.

Perang ini adalah perang yang sangat sengit meski jumlah korban hanya sedikit dari pihak muslim. Di dalam peperangan ini Khalid Radhiyallâhu ‘anhu telah menunjukkan suatu kegigihan yang sangat mengagumkan. Imam Bukhari meriwayatkan dari Khalid sendiri bahwa ia berkata: “Dalam perang Mu‘tah, sembilan bilah pedang patah di tanganku kecuali sebilah pedang kecil dari Yaman.” Ibnu Hajar mengatakan, Hadis ini menunjukkan bahwa kaum Muslimin telah banyak membunuh musuh mereka.

QS. Al-Muzzammil ayat 20

bismillah
Artinya :
Sesungguhnya Tuhanmu mengetahui bahwasanya kamu berdiri (sembahyang) kurang dari dua pertiga malam, atau seperdua malam atau sepertiganya dan (demikian pula) segolongan dari orang-orang yang bersama kamu. Dan Allah menetapkan ukuran malam dan siang. Allah mengetahui bahwa kamu sekali-kali tidak dapat menentukan batas-batas waktu-waktu itu, maka Dia memberi keringanan kepadamu, karena itu bacalah apa yang mudah (bagimu) dari Al Qur’an. Dia mengetahui bahwa akan ada di antara kamu orang-orang yang sakit dan orang-orang yang berjalan di muka bumi mencari sebagian karunia Allah; dan orang-orang yang lain lagi berperang di jalan Allah, maka bacalah apa yang mudah (bagimu) dari Al Qur’an dan dirikanlah sembahyang, tunaikanlah zakat dan berikanlah pinjaman kepada Allah pinjaman yang baik. Dan kebaikan apa saja yang kamu perbuat untuk dirimu niscaya kamu memperoleh (balasan)nya di sisi Allah sebagai balasan yang paling baik dan yang paling besar pahalanya. Dan mohonlah ampunan kepada Allah; sesungguhnya Allah Maha Pengampun lagi Maha Penyayang.

Penjelasan Syi’ah : 

Ayat ini turun berkaitan dengan Utsman bin Mazh’un. Beliau termasuk pada “segolongan/tahifah dalam Qs. Al Muzammil ayat 20

Aisyah bertutur : “Datang kepadaku istri Utsman bin Mazh’un dalam keadaan lusuh. Aku tanya mengapa. Ia berkata, “Suamiku puasa siang, shalat malam, terus menerus”. Aku ceritakan hal itu kepada Nabi SAW. Rasulullah menemui Utsman dan berkata , “Hai Utsman, kependetaan tidak diwajibkan atas kita. Tidakkah kamu mengambilku sebagai contoh  ? Demi Allah, aku paling takut kepada Allah, dan paling memelihara hukum hukumnya”

.

Q.S. Al- Maidah ayat 93

laysa ‘alaa alladziina aamanuu wa’amiluu alshshaalihaati junaahun fiimaa tha’imuu idzaa maa ittaqaw waaamanuu wa’amiluu alshshaalihaati tsumma ittaqaw waaamanuu tsumma ittaqaw wa-ahsanuu waallaahu yuhibbu almuhsiniina
.
93. Tidak ada dosa bagi orang-orang yang beriman dan mengerjakan amalan yang saleh karena memakan makanan yang telah mereka makan dahulu, apabila mereka bertakwa serta beriman, dan mengerjakan amalan-amalan yang saleh, kemudian mereka tetap bertakwa dan beriman, kemudian mereka (tetap juga) bertakwa dan berbuat kebajikan. Dan Allah menyukai orang-orang yang berbuat kebajikan.Penjelasan Syi’ah : Menurut Ibn ‘Abd Al Birr, sehubungan dengan perilaku Utsman dan sahabat sahabat yang ingin terus menerus beribadah maka turunlah Qs. Al Maidah ayat 93 (Al Isti’ab 3:186).

bismillahUtsman bin Maz`un (wafat 2 H/624 M) (Bahasa Arab عثمان بن مظعون) adalah salah satu sahabat nabi. Ia termasuk cendekiawan Arab di zaman jahiliyah, sempat mengikuti Perang Badardan meninggal dunia sekembalinya dari perang tersebut. Sepeninggal Utsman, Muhammad menciumnya sambil mengalirkan air mata. Utsman inilah sahabat pertama yang meninggal diMadinah.

Utsman inilah yang pernah berniat membujang dan meninggalkan keduniawian, akan tetapi Muhammad melarangnya dari niat tersebut. Kemudian Utsman bin Mazh’un menikah denganKhawlah binti Hakim.

Wisudawan Madrasah Rasulullah saw (1)

REFORMASI Agung kedua yang dilakukan Rasulullah adalah dengan mengubah kesetiaan kepada kelompok menjadi kesetiaan kepada Islam. Sekarang saya ingin memberikan contoh keberhasilan reformasi kedua itu melalui kehidupan beberapa sahabat yang lulus dari Madrasah Rasulullah saw. Tidak semua sahabat lulus dari Madrasah Rasulullah. Ada juga sahabat yang diskors selama tiga bulan dan semua sahabat-sahabat Nabi yang lain dilarang berbicara dengan dia. Sampai sahabat Nabi itu kemudian lari ke gunung, bertaubat siang dan malam.

Para sahabat yang lulus dari madrasah Rasulullah saw, anehnya, banyak yang tidak kita kenal. Salah seorang tokoh yang tidak begitu kita kenal adalah Utsman bin Mazh’un, dia dikuburkan di Baqi. Bapaknya adalah Mazh’un bin Wahab bin Hudzafah bin Jumuh Al-Quraisyi. Sedangkan Ibunya ialah Suhailah binti Al-Anbas bin Ahban bin Khudzafah bin Jumuh.

Utsman masuk Islam beserta seluruh keluarganya. Dia adalah orang ketigabelas yang masuk Islam. Dia sangat rajin beribadah. Ia pun hijrah dua kali ke Habsyi. Dia ikut berperang di Badar bersama Rasulullah saw. Dia meninggal dua setengah tahun setelah Hijrah. Nabi menguburkannya di Baqi dan memberi tanda di kuburan Utsman dengan batu. Nabi sering menziarahi kuburannya. Hal ini sekaligus merupakan dalil bahwa ziarah ke kubur itu ialah sunnah Rasulullah saw. Kelak, salah seorang putera Utsman syahid pada hari Yamanah, ketika kelompok Musailamah Al-Kadzab melakukan perlawanan.

Kesetiaan Utsman bin Mazh’un kepada Allah dan Rasul-Nya lebih tinggi daripada kesetiaannya kepada yang lain. Ketika orang-orang Islam dikejar-kejar dan dianiaya, Utsman hijrah ke Habsy beserta seluruh keluarganya. Seperti kita ketahui, ‘Amr bin ‘Ash menyusul ke Habsyi dan meminta Utsman supaya kembali lagi ke Mekkah. ‘Amr bin ‘Ash juga meminta kepada Raja Habsyi supaya tidak menerima umat Islam di negeri itu dan mengembalikannya ke Mekkah.

Ketika Utsman bin Mazh’un kembali dari Habsyi ke Mekkah, penindasan masih berlangsung. Orang-orang Islam masih disiksa dan dianiaya. Dia menghadapi ancaman terhadap dirinya dan keluarganya. Akhirnya dia mencari perlindungan kepada keluarga Al-Walid bin Mughirah, seorang penyair yang sejak dulu dekat dengan Utsman.

Pada awalnya, Utsman bin Mazh’un masuk Islam karena rasa malu. Rasulullah saw sering berdakwah kepadanya dan berulang kali mengajak Utsman bin Mazh’un masuk Islam. Utsman pernah berkata, “Aku ini masuk Islam karena malu saja. Rasulullah berulang kali mengajak aku untuk masuk Islam. Waktu itu Islam belum ada dalam hatiku. Sampai suatu hari aku sedang bersama Rasulullah, tiba-tiba Rasul memandang ke langit. Seakan-akan beliau sedang memahami sesuatu. Setelah Rasul merenung, aku bertanya kepada Rasul tentang apa yang terjadi. Lalu Rasul menjawab, “Allah menyuruh kamu untuk berbuat baik dan memberikan hak kepada keluargamu. Dan Allah melarang kamu dari keburukan dan kemungkaran.” (QS Al-Nahl 90).

“Waktu itu, menetaplah Islam dalam hatiku. Itulah saatnya aku masuk Islam yang sungguh-sungguh, karena aku tersentuh oleh ayat yang indah itu. Lalu aku datangi paman Nabi, Abu Thalib, dan aku kabarkan ke-islamanku. Beliau memberi nasehat, “Ya Ahli Quraisy, ikuti Muhammad, nanti kamu mendapat petunjuk. Karena Muhammad tidak memerintah kecuali kepada akhlak yang mulia.”

“Kemudian aku datangi Walid bin Mughirah, aku bacakan ayat itu dan Mughirah pun terpesona. Dia berkata, “Sungguh dalam ayat-ayat itu ada kemanisan-nya. Di atasnya juga ada keindahannya. Pada puncaknya ada buahnya. Dan di bawahnya rimbun. Ini bukan ucapan manusia. Kalau itu ucapan Muhammad, alangkah bagusnya ucapan Muhammad itu. Dan kalau itu ucapan Tuhannya, alangkah bagusnya ucapan Tuhannya itu”.

Walid bin Mughirah memang dekat dengan Utsman bin Mazh’un, meskipun dia tidak masuk Islam. Malahan ia termasuk dedengkot kekufuran. Tapi kepada Walid bin Mughirah, Utsman bin Mazh’un berlindung. Dan Walid bin Mughirah melindungi dia. Sehingga dia tidak diganggu oleh orang-orang kafir. Sementara orang-orang Islam yang lain menderita, Utsman bin Mazh’un ber-senang-senang di bawah perlindungan Walid bin Mughirah.

Utsman berkata, “Demi Allah, pagi dan soreku tentram dalam perlindungan seseorang yang musyrik. Sedangkan sahabat-sahabatku dan teman seagamaku sekarang menderita barbagai bala dan kesulitan karena Allah. Itu semua tidak menimpaku. Sungguh keadaanku ini adalah sebuah kekurangan yang besar, sebuah aib besar untuk diriku.”

Kemudian Utsman bin Mazh’un datang menemui Walid bin Mughirah, “Wahai Abâ ‘Abdi Syam, sudah selesai sekarang perlindunganmu itu. Aku kembalikan perlindunganmu itu.” Walid menjawab, “Kenapa kau kembalikan perlindungan itu, hai anak saudaraku? Apakah ada seseorang dari kaumku yang menyakitimu?” “Tidak,” jawab Utsman, “bukan karena itu. Tapi aku ingin memilih perlindungan Allah dan aku tidak ingin meminta perlindungan kepada selain Dia.” Walid berkata, “Kalau begitu, berangkatlah kamu ke mesjid dan umumkan terang-terangan bahwa kamu sudah menolak perlindunganku.” Keduanya pun lalu berangkat ke mesjid. Di sana Walid meng-umumkan, “Ini Utsman, dia menolak perlindunganku.” Utsman mengatakan, “Benar apa yang dia katakan dan dia sudah melindungi aku dengan sebaik-baiknya. Tapi aku lebih senang untuk berlindung kepada Allah saja dan karena itu aku kembalikan perlindungan Walid.”

Pada waktu itu datang rombongan tokoh-tokoh Quraisy, salah seorang di antaranya ialah Walid bin Rabiah bin Malik bin Ja’far bin Kilab dari Bani Kilab yang juga duduk di situ. Lalu ada seorang yang bernama Lubaib dari Bani Kilab yang ketika mendengar Utsman bin Mazh’un telah melepaskan perlindungan Walid bin Mughirah, dia membacakan sebuah syair, “Sungguh segala sesuatu selain Allah itu akhirnya jadi bathil.” “Shadaqta. Kamu benar”, kata Utsman. Kemudian Lubaib meneruskan syairnya, “Semua nikmat akhirnya akan berakhir juga.” Maksud Lubaib, perlindungan Mughirah itu sekarang berakhir semua. Utsman berkata, “Kamu dusta. Kenikmatan surga tidak akan pernah berakhir.” Lalu Lubaib berteriak, “Hai Quraisy, lihatlah orang yang duduk bersama kalian ini! Dia termasuk orang-orang bodoh yang meninggalkan agama kita.” Utsman terus membantahnya, sampai Lubaib marah. Kemudian salah satu telinga dan mata Utsman dipukul, sehingga matanya lebam karena pukulan.

Walid bin Mughirah, yang dulu sebagai pelindung Utsman, berada di situ dan berkata, “Hai anak saudaraku, sekiranya mata kamu itu sehat, itu karena dulu kau berada pada perlindungan yang kokoh.” Walid bermaksud menyindir Utsman. Tapi Utsman berkata, “Demi Allah, mataku yang sehat ini sekarang iri dengan mata yang lain dalam membela agama Allah.” Utsman menantang untuk dipukul lagi. Walid berkata, “Mari ke sini, Hai anak saudaraku. Kalau engkau mau, aku akan melindungimu.” “Tidak,” kata Utsman.

Ketika matanya hampir pecah karena dipukul, dia kemudian melantunkan syair yang berisi pujian tentang matanya: “Jika mataku, karena mencari rido Tuhan, mendapat pukulan tangan mulhid, ateis sesat. Tuhan Maha Pengasih telah menggantinya dengan pahala. Siapa yang mendapat rido Rahman pasti bahagia.”

Utsman bin Mazh’un adalah contoh orang yang meninggalkan kesetian kepada kelompoknya karena kesetian kepada Allah. Dia meninggalkan tribalisme menuju Tauhidul Ummah, menuju Al-Ukhuwah Al-Islamiyyah, persaudaran Islam.

Ada beberapa ayat Al-Qur’an turun berkenaan dengan Utsman bin Mazh’un. Utsman termasuk pada “segolongan” (thâifah) dalam ayat “Sesungguhnya Tuhanmu menge-tahui bahwa kamu berdiri (sembahyang) kurang dari dua pertiga malam, atau seperdua malam atau sepertiganya dan (demikian pula) segolongan dari orang-orang yang bersama kamu.” (Al-Muzammil 20). Menurut A’isyah: Datang kepadaku istri Utsman bin Mazh’un dalam keadaan lusuh. Aku tanya mengapa. Ia berkata, “Suamiku puasa siang, salat malam, terus menerus.” Datang Nabi saw. aku sebutkan hal itu. Rasulullah saw menemui Utsman dan berkata: “Hai Utsman, kependetaan tidak diwajibkan atas kita. Tidakkah kamu mengambilku sebagai contoh? Demi Allah, aku paling takut kepada Allah, dan paling memelihara hukum-hukumnya.”

Menurut Ibn ‘Abd Al-Birr, sehubung-an dengan perilaku Utsman dan sahabat-sahabat yang ingin terus menerus ibadah, turun ayat Al-Maidah 93: “Tidak ada dosa bagi orang-orang yang beriman dan mengerjakan amalan yang saleh karena memakan makanan yang telah mereka makan dahulu, apabila mereka bertakwa serta beriman, dan mengerjakan amalan-amalan yang saleh, kemudian mereka tetap bertakwa dan beriman, kemudian mereka (tetap juga) bertakwa dan berbuat kebajikan. Dan Allah menyukai orang-orang yang berbuat kebajikan.” (Al-Isti’ab 3:186).

Rasulullah mengunjunginya ketika dia sakit. Ketika dia meninggal dunia, Rasulullah saw ikut menguburkan jenazah-nya. Rasulullah saw juga menangisi kepergian Utsman bin Mazh’un. Sejak zaman Jahiliyyah, Utsman bin Mazh’un memang berakhlak bagus, apalagi setelah dia masuk Islam. Nabi berkata, “Manusia itu seperti logam. Kalau di Zaman Jahiliyyah emas, setelah Islam pun emas juga.”

Ibnu Ishaq meriwayatkan Utsman sebagai, “Orang yang paling banyak beribadah. Puasa di waktu siang hari dan shalat di malam hari. Dia menjauhi syahwat dan meninggalkan perempuan. Kemudian dia meminta izin kepada Rasulullah saw untuk mengebiri dirinya tetapi Rasulullah melarangnya. Sejak Zaman Jahilliyah, dia tidak pernah minum khamar. Dia beralasan, “Aku tidak akan minum satu minuman yang menyebabkan akal pikiranku hilang”.

“Waktu Rasulullah saw ditinggalkan oleh putranya yang sangat dicintainya, yaitu Ibrahim yang meninggal di Madinah, Nabi mendampingkan kuburannya di samping kuburan Utsman bin Mazh’un. Beliau bersabda, “Kuburkan Ibrahim di dekat pendahulu kita yang saleh.”

Utsman bin Mazh’un

Utsman bin Mazh’un
.
Tatkala cahaya agama Islam mulai bersinar dari kalbu Rasulullah saw dan dari ucapan-ucapan yang disampaikannya di beberapa majelis, baik secara diam-diam maupun terang-terangan, Utsman bin Mazh’un adalah salah seorang dari beberapa gelintir manusia yang segera menerima panggilan Ilahi dan menggabungkan diri ke dalam kelompok pengikut Rasulullah saw. Ia adalah di antara sahabat Nabi saw yang masuk Islam pada urutan keempat belas
.
Dalam kehidupannya, ia pun tidak luput dari ancaman kaum biadab golongan kuffar Qurasy yang tidak menyukai kedatangan dan keberadaan agama baru, Islam. Ia ditempa oleh berbagai derita dan siksa, sebagaimana dialami oleh orang-orang Mukmin lainnya, pengikut setia pembawa risalah baru yang lurus, Rasulullah saw.Ketika keselamatan golongan kecil dari orang-orang beriman dan teraniaya ini menjadi pilihan utama Rasulullah saw, dengan jalan menyuruhnya berhijrah ke Habsyi, maka dipilihlah seorang yang juga membawa puteranya bernama Saib, Utsman bin Mazh’un, memimpin rombongan pertama dari Muhajirin ini.

Dalam perantauannya, Utsman bin Mazh’un tidak dapat melupakan rencana-rencana jahat mereka termasuk saudara sepupunya, Umayah bin Khalaf. Dihiburlah dirinya dengan menggubah sya’ir yang berisikan sindiran dan peringatan terhadap saudaranya itu, katanya:

“Kamu melengkapi panah dengan bulu-bulunya
Kamu runcing ia setajam-tajamnya
Kamu perangi orang-orang yang suci lagi mulia
Kamu celakan ornag-orang yang berwibawa
Ingatlah nanti saat bahaya datang menimpa
Perbuatanmu akan mendapat balasan dari rakyat jelata”

Suatu ketika tersiarlah kabar bahwa orang-orang Qurasy telah beriman dan menganut agama yang dibawa oleh Rasulullah saw. Dengan hati riang dan gembira, bangkitlah orang-orang Muhajirin mengemasi barang-barangnya untuk kembali ke Mekah. Mereka sungguh telah merindukan kampung halamannya.

Akan tetapi, baru saja mereka sampai di dekat kota, ternyata berita tentang masuknya kaum Quraisy telah beriman hanyalah berita bohong belaka. Mereka benar-benar merasa terpukul dengan kejadian dan tipuan ini. Betapa tidak, untuk pergi lagi perjalanan mereka sudah terlanjur sampai dekat kota Mekah. Sementara itu, orang-orang musyrik di kota Mekah telah mendengar datangnya buronan yang telah lama mereka kejar-kejar. Perangkap-perangkap pun mereka siapkan. Takdir telah menentukannya, datanglah barisan kaum Muslimin ke tampat itu.

Untungnya, nasib baik masih menyertai Utsman bin Mazh’un sebagai pemimpin rombongan kala itu. Perlindungan ketika itu merupakan suatu tradisi di antara tradisi-tradisi Arab yang memiliki kekudusan dan sangat dihormati. Sekiranya ada seorang yang lemah yang beruntung masuk dalam perlindungan salah seorang pemuka Quraisy, maka ia akan berada dalam suatu pertahanan yang kokoh, hingga darahnya tidak boleh ditumpahkan. Hanya sebagian kecil yang dapat masuk memperoleh perlindungan itu. Termasuk di antaranya adalah Utsman bin Mazh’un yang berada dalam perlindungan Walid bin Mughirah. Ia pun selamat hingga masuk ke kota Mekah.

Di tengah keberadaan kaum Muslimin di Mekah yang dilanda kecemasan dan ketakutan karena perlakuan orang-orang musyrik, Utsman bin Mazh’un, seorang yang telah ditempa Al-Qur’an dan didikan langsung dari Rasulullah saw, merasa prihatin dan dalam dirinya timbul perasaan berontak menyikapi keadaan itu. Utsman bin Mazh’un keluar dari rumah perlindungannya dengan tekad dan niat yang bulat.

Mari kita dengarkan cerita dari saksi mata yang melukiskan kejadian peristiwa itu!

“Ketika Utsman bin Mazh’un menyaksikan penderitaan yang dialami oleh para sahabat Rasulullah saw, sementara ia sendiri pulang pergi dengan aman dan tenteram disebabkan perlindungan Walid bin Mughirah, katanya, ‘Demi Allah, sesungguhnya mondar-mandirku dalam keadaan aman disebabkan perlindungan seorang tokoh golongan musyrik, sedang teman-teman sejawat dan kawan-kawan seagama menderita adzab dan siksa yang tidak kualami, merupakan suatu kerugian besar bagiku ….’

“Lalu ia pergi mendapatkan Walid bin Mughirah, katanya, ‘Wahai Abu Abdi Syams, cukuplah sudah perlindungan Anda, dan sekarang ini saya melepaskan diri dari perlindungan Anda.’ ‘Mengapa, wahai keponakanku?’ ujar Walid. ‘Mungkin ada salah seorang anak buahku yang mengganggumu?’ ‘Tidak,’ ujar Utsman bin Mazh’un. ‘Hanya, saya ingin berlindung kepada Allah, dan tidak suka lagi kepada lain-Nya. Karenanya, pergilah Anda ke masjid serta umumkanlah maksudku ini secara terbuka seperti Anda dahulu mengumumkan perlindungan terhadap diriku!”

“Lalu, pergilah mereka berdua ke masjid, maka kata Walid, ‘Utsman ini datang untuk mengembalikan kepadaku jaminan perlindungan terhadap dirinya.’ Ulas Utsman, ‘Betullah kiranya apa yang dikatakan itu …, ternyata ia seorang yang memegang teguh janjinya …, hanya keinginan saya agar tidak lagi mencari perlindungan kecuali kepada Allah Ta’ala.”

Setelah itu, Utsman bin Mazh’un pun berlalulah, sementara di salah satu gedung pertemuan kaum Quraisy, Lubaid bin Rabi’ah menggubah sebuah syair dan melagukannya di hadapan mereka, hingga Utsman bin Mazh’un menjadi tertarik karenanya dan ikut duduk bersama mereka. Kata Lubaid:

“Ingatlah bahwa apa juga yang terdapat di bawah kolong ini selain dari Allah adalah hampa.” “Benar, ucapan Anda itu,” kata Utsman bin Mazh’un menanggapinya. Kata Lubaid lagi, “Dan semua kesenangan, tak dapat tiada lenyap dan sirna.” “Itu dusta!” kata Utsman, “Karena kesenangan surga takkan lenyap.” Kata Lubaid:

“Hai orang-orang Qurasy! Demi Allah, tak pernah aku sebagai teman duduk kalian disakiti orang selama ini. Bagaimana sikap kalian kalau ini terjadi?” Berkatalah salah seorang di antara mereka, “Si tolol ini telah meninggalkan agama kita, jadi tidak usah digubris, apa ucapannya!”

Utsman bin Mazh’un membalas ucapannya itu hingga di antara mereka terjadi pertengkaran. Dengan perasaan marah, orang itu tiba-tiba bangkit mendekati Utsman lalu meninjunya hingga tepat mengenai matanya, sementara Walid bin Mughirah masih berada di dekat itu dan menyaksikan apa yang terjadi. Maka katanya kepada Utsman, “Wahai keponakanku, jika matamu kebal terhadap bahaya yang menimpa, maka sungguh, benteng perlindunganmu amat tangguh!” Ujar Utsman, “Tidak, bahkan mataku yang sehat ini amat membutuhkan pula pukulan yang telah dialami saudaranya di jalan Allah. Dan sungguh wahai Abu Syams, saya berada dalam perlindungan Allah yang lebih kuat dan lebih mampu daripadamu.” “Ayuhlah Utsman,” kata Walid pula, “Jika kamu ingin, kembalilah masuk ke dalam perlindunganku!” “Terima kasih,” ujar Ibnu Mazh’un menolak tawaran itu. Ibnu Mazh’un kemudian meninggalkan tempat itu; Utsman pun pergi. Di tengah perjalanan menuju rumahnya, dengan hati gembira, ia mendendangkan pantun:

“Andaikata dalam mencintai ridla Ilahi
Mataku ditinju tangan jahil orang mulhidi
Maka Yang Maha Rahman telah menyediakan imbalannya
Karena siapa yang diridhai-Nya pasti berbahagia
Hai ummat, walau menurut katamu daku ini sesat
Daku ‘kan tetap dalam agama Rasul, Muhammad
Dan tujuanku tiada lain hanyalah Allah dan agama yang haq
walaupun lawan berbuat aniaya dan semena-mena.”

Utsman bin Mazh’un telah memperlihatkan kepada kita suatu teladan yang menunjukan pribadi utama yang harum semerbak disebabkan pendiriannya yang luar biasa.

Setelah tidak mendapatkan perlindungan dari Walid, Utsman bin Mazh’un mulai mendapat siksaan dari orang-orang Quraisy. Akan tetapi, karena ketabahan dan kekuatan jiwanya, penderitaannya dirasakan dengan ikhlas dan bahagia.

Suatu ketika Utsman bin Mazh’un hijrah pula ke Madinah, hingga tidak diusik lagi oleh Abu Lahab dan kawan-kawannya. Ia berangkat ke Madinah bersama rombongan sahabat-sahabat utama yang dengan keteguhan dan ketabahan hati mereka telah lulus dalam ujian yang telah mencapai puncak kesulitan dan kesukarannya.

Di Madinah, tempat hijrahnya yang baru itu, Utsman bin Mazh’un sangat tekun dan rajin beribadah: malam harinya bagai rahib dengan ibadah shalat dan dzikirnya; siang harinya bagai pahlawan dengan berjuang membela kebenaran. Dengan ketabahan dalam zuhud dan ketekunan dalam ibadahnya, ia mencapai puncak tertinggi, hingga corak kehidupannya, baik siang maupun malam dialihnya menjadi shalat yang terus-menerus dan tasbih yang tiada henti-hentinya. Rupanya ia telah memperoleh dan merasakan kemanisan beribdah kepada Allah SWT.

Dengan berpakaian usang yang telah sobek-sobek; yang ditambalnya dengan kulit unta, suatu hari ia masuk masjid, sementara Rasulullah sedang duduk-duduk bersama para sahabatnya. Rasulullah saw kemudian bertanya kepada para sahabatnya:

“Bagaimana pendapat Kalian, bila Kalian punya pakaian satu stel untuk pakaian pagi dan sore hari diganti dengan stelan lainnya … kemudian disiapkan di depan kalian suatu perangkat wadah makanan sebagai ganti perangkat lainnya yang telah diangkat … serta kalian dapat menutupi rumah-rumah kediaman kalian sebagaimana Ka’bah bertutup ….?”

“Kami ingin hal itu dapat terjadi, wahai Rasulullah,” ujar mereka, “… hingga kita dapat mengalami hidup makmur dan bahagia!” Maka sabda Rasulullah saw, “Sesungguhnya hal itu telah terjadi, kemudian Kalian sekarang ini lebih baik dari keadaan Kalian waktu lalu.”

Meskipun Utsman bin Mazh’un ikut mendengarkan percakapan itu, ia tidak terpengaruh dengan jawaban para sahabat yang mengharapkan berbagai kecukupan. Ia tetap menjalani hidup dengan bersahaja dan menghindari sejauh-jauhnya kesenangan dunia, sampai-sampai kepada urusan menggauli isterinya hendak menahan diri. Rasulullah pun memanggil dan menyampaikan kepadanya, “Sesungguhnya keluargamu itu mempunyai hak atas dirimu.”

Utsman bin Mazh’un amat dicintai oleh Rasulullah saw. Tatkala ruhnya yang suci itu berkemas-kemas hendak berangkat menuju tempat tujuannya, Rasulullah berada di sisinya. Beliau saw membungkuk dan mencium keningnya, seraya membasahi kedua pipinya dengan derai air mata. Wajah Utsman bin Mazh’un tampak bersinar gilang-gemilang saat kematiannya. Ia seorang Muhajirin yang kali pertama wafat di Madinah; juga yang pertama kali dimakamkan di Baqi’.

Bersabdalah Rasulullah saw melepas sahabatnya yang tercinta itu:
“Semoga Allah memberimu rahmat, wahai Abu Saib….
Kamu pergi meninggalkan dunia, tak satu keuntungan pun yang kamu peroleh daripadanya, serta tak satu kerugian pun yang dideritanya daripadamu.”

Sepeninggal sahabatnya itu, Rasulullah tidak melupakannya. Ketika melepas puterinya, Rukayah; ketika nyawanya hendak melayang, Beliau pun berkata:

“Pergilah susul pendahulu kita yang pilihan, Utsman bin Mazh’un!”


Orang-orang kafir Quraiys amat gusar mendengar hijrahnya beberapa kaum muslimin ke negeri Habasyah. Mereka mengutus Amr ibnul ‘Ash dan Abdullah ibnu Abdi Rabi’ah untuk membujuk Raja Habasyah agar mau mengusir kaum muslimin dari negerinya. Namun, sang Raja menolaknya. Ia tetap melindungi kaum muslimin Makkah.

rang-orang  Quraiys tak kurang akal. Beberapa waktu berselang, mereka mengabarkan kepada kaum muslimin yang hijrah, bahwa tokoh-tokoh Quraisy sudah masuk Islam. Sehingga jika mereka kembali, mereka tak lagi mengalami siksaan.

Kaum muslimin di negeri Habasyah menyambut gembira kabar ini. Mereka sudah rindu kampung halaman, dan ingin segera bertemu Rasulullah. Mereka pun segera kembali ke Makkah.

Alangkah terkejutnya mereka. Sesampai di Makkah, orang-orang kafir menangkap mereka dan menyiksa mereka. Hanya satu orang yang tak diusik. Dia adalah Utsman bin Mazh’un. Orang-orang kafir Quraisy tak berani menangkapnya, karena pamannya, Walid bin Mughirah, yang juga salah satu tokoh Quraisy telah memberikan jaminan keamanan baginya. Utsman pun selamat.

Bukannya senang dengan perlindungan ini, Utsman bin Mazh’un justru merasa sedih. Ia sedih menyaksikan saudara-saudaranya seiman mengalami penderitaan dan penyiksaan. Hatinya berontak. Ia lantas menghadap sang paman, Walid bin Mughirah yang memberikan jaminan keamanan.

“Wahai Abu Abdi Syam (sebutan penghormatan bagi Walid bin Mughirah), sejak saat ini aku melepaskan perlindungan yang telah engkau berikan padaku. Karena aku tidak ingin mendapatkan perlindungan selain dari Allah. Umumkanlah hal ini, seperti waktu engkau umumkan perlindungan atasku sebelumnya,” kata Utsman dengan suara lantang.

Sang paman tak menyangka, kemenakannya akan mengatakan hal ini. Tapi ia tak mampu menolaknya. Walid lantas mengumumkan kepada warga Makkah, bahwa ia telah melepaskan perlindungan atas Utsman bin Mazh’un.

Mendengar pengumuman ini, kaum Quraisy bergegas mendatangi Utsman dan mulai menyiksanya. Utsman menerimanya dengan lapang dada. Ia bangga karena kini menerima nasib sama dengan saudara-saudara seimannya. Ia menikmati siksaan demi siksaan itu dengan kesabaran. Baginya, lebih baik berlindung kepada Allah daripada mendapat perlindungan manusia.

Sebenarnya sang paman bersedia memberikan perlindungan lagi, agar Utsman tak lagi disiksa. Tapi, Utsman menolak tawaran itu. Dengan tenang ia berkata, “Mataku yang sehat ini memerlukan pukulan seperti yang telah dirasakan saudara-saudaraku seiman. Sebenarnya aku berada dalam perlindungan Allah, yang lebih kuat dari perlindungan yang bisa engkau berikan untukku.”

Dan kesabaran Utsman berbuah manis. Setelah berbagai siksaan dan pukulan diterimanya dengan tabah, ia pun memenuhi perintah Rasulullah untuk berangkat hijrah ke Madinah besama kaum muslimin lainnya.

Di Madinah, umat Islam dapat beribadah dengan tenang. Mereka bisa mempelajari Al-Qur’an dari Rasulullah tanpa rasa takut dan khawatir. Utsman bin Mazh’un pun menjadi sahabat yang cukup ternama. Utsman adalah orang yang ahli ibadah dan seorang zahid, waktunya habis untuk mendekatkan diri kepada Allah. Sepanjang siang dan malam ia habiskan waktu untuk shalat, membaca Al-Quran, dan puasa.

Tokoh yang satu ini termasuk kelompok yang pertama masuk Islam, yakni pada urutan yang keempatbelas. Baliau termasuk orang yang pertama juga dari kaumMuhajirin yang hijrah ke Madinah dan sekaligus menjadi orang pertama yang wafat di Medinah, karenanya menjadi yang pertama pula dari ummat Islam yang dikuburkan diBaqi.

Beliau dikenal sebagai orang yang suci dan punya kepribadian dan hati yang suci dalam beribadah kepada Allah SWT. Beliau suci bukan karena mengucilkan diri (‘Uzlah) jauh dari kehidupan yang bisa mengantarkan orang kepada kesesatan, tapi suci di tengah-tengah kehidupan masyarakat yang jahil. Corak kehidupannya sangat berbeda dengan konsep hidup kaum sufi pada umumnya yang sebagian mereka berpendapat atau memiliki prinsip “Uzlah” untuk mengambil sikap mengasingkan diri dari kelompok masyarakatnya yang tidak sejalan dengan prinsip hidup seorang mu’min

.

     Paling tidak, ada “dua” pola pendekatan yang berbeda yang dilakukan oleh umumnya orang Islam dan kelompok Sufi. Keduanya tentu saja sama-sama hidup di jalan Allah, namun dengan “Manhaj”(Metoda) yang agak berbeda dalam mengartikan “Uzlah”. Di mana yang satu mengartikannya dengan mengasingkan diri, atau hijrah dari sebuah kondisi masyarakat yang tidak kondusif untuk berkembangnya keimanan dan kesholehan seseorang. Namun, sementara yang lain tidak sependapat dengan pemaknaan “Uzlah” seperti itu
.
     Yang paling menonjol dari diri Utsman bin Mazh’un adalah “Mujahadah”nya, yakni upaya yang sungguh-sungguh untuk hidup di jalan Allah dengan melakukan semua yang dicintai Allah dan meninggalkan segala yang dibenci-Nya dan untuk itu beliau tidak pernah mengasingkan diri dari masyarakat, sebaliknya beliau senantiasa siap menghadapi segala resiko yang terjadi termasuk siap menghadapi siksaan yang sudah biasa dihadapi oleh orang-orang yang baru masuk Islam. Kala itu beliau hadapi segala macam siksaan dengan kesabaran dan tidak pernah berniat sedikit pun untuk lari dari kondisi yang dialaminya
.
     Beliau baru mau berhijrah ke Habsy setelah Rasulullah Saw memerintahkan Utsman dan para sahabat yang lain meninggalkan Mekah yang sangat tidak kondusif bagi orang-orang mu’min saat itu. Mereka pun berhijrah lalu menemukan lingkungan di Habsyi yang membuat mereka merasa aman dan nyaman serta bisa meninggalkan lingkungan para penyembah berhala yang telah membuat mereka “muak” melihatnya. Di Habsyi mereka hidup di lingkungan orang-orang Nasrani. Kedatangan mereka dimanfaatkan oleh orang-orang Nasrani untuk mendakwahi dengan maksud agar orang-orang muslim masuk dalam keyakinan mereka. Para sahabat yang hijrah ke Habsyi di bawah pimpinan Utsman bin Mazh’un, tidak mungkin mengikuti ajakan mereka lari dari satu kekufuran lalu masuk ke dalam kekufuran yang lain, keluar dari kesesatan yang satu lalu masuk ke dalam kesesatan yang lain. Karena mereka yakin, “Hanya Islamlah satu-satunya agama yang benar” (QS. Ali Imran, 3:19;85)
.
     Ketika mereka sedang menikmati kehidupan yang tenang dan nyaman dalam beribadah dan mempelajari Al Qur’an, tiba-tiba muncul berita bahwa di Mekah, orang orang Quraisy dan para tokohnya telah masuk Islam. Berita yang cukup menggembirakan ini menjadikan mereka ingin sekali segera kembali ke Mekah dan mereka pun segera bersiap-siap. Namun, pada saat akan memasuki Mekah, arulah mereka menyadari, bahwa berita tersebut hanya fitnah dan tipu daya belaka sehingga membuat Utsman dan para sahabat betul-betul merasa terpukul atas kecerobohan mereka yang tidak menyelidiki dulu kebenaran berita tersebut. Padahal, mereka saat itu sudah berada di pintu masuk kota Mekah. Sementara itu orang-orang musyirikin yang mendengar akan kehadiran mereka yang dianggap “buronan” menyambut berita tersebut dengan suka cita. Bagi orang-orang musyirikin, Utsman dan para sahabat yang mau menegakkan kebenaran dianggap “buronan”
.
     Di masyarakat Arab Jahilliyyah saat itu berlaku sistim perlindungan, di mana setiap orang bisa mencari pelindung yang tentu saja dari tokoh Quraisy yang disegani. Menyikapi situasi dan kondisi tersebut, Utsman dan para sahabat berupaya mencari perlindungan. Namun tidak semuanya berhasil. Salah satu yang berhasil adalah Utsman bin Mazh’un yang mendapat perlindungan dari Walid bin Mughirah, seorang tokoh musyirikin Quraisy yang disegani. Karena mendapat perlindungan dari Walid, maka Utsman bin Mazh’un bebas masuk ke Mekah dengan tenang, tidak ada yang berani mengganggu karena Walid sudah mengumumkan di depan masjid bahwa Utsman ada dalam perlindungannya
.
Mendapat perlindungan dari Walid sebenarnya hati Utsman kemudian menjadi sangat tidak tenang, pada saat beliau melihat saudara-saudaranya yang miskin dan lemah tidak menemukan orang untuk melindungi mereka, sehingga mereka harus menerima siksaan yang tidak tertahankan. Melihat saudara-saudaranya hidup dalam penderitaan, batin Utsman bin Mazh’un tidak rela. Akhirnya beliau memutuskan menemui Walid bin Muqhirah untuk menyatakan keinginannya melepaskan diri
.
Kisahnya dapat diikuti sebagaimana diriwayatkan oleh seorang sahabat: “Ketika Utsman bin Mazh’un melihat beberapa sahabat Rasul mengalami penderitaan yang sangat luar biasa, sementara ia aman dalam perlindungan Walid bin Mughirah, lalu ia berkata dalam hatinya, Demi Allah, sesungguhnya saat ini aku sedang berlindung kepada musuh Allah, sementara sahabat-sahabatku merasakan berbagai azab dan siksaan, maka ia pun segera menemui Walid bin Mughirah dan berkata: “Wahai Abu Abdi Syams (Walid), bebaskan aku dari perlindunganmu! Berkata Walid: Kenapa wahai anak pamanku? Sementara orang lain susah mencari pelindung kau malah minta dibebaskan dari perlindunganku, jika kulepaskan maka boleh jadi kau akan disiksa oleh kaumku. Jawab Utsman: “Tidak, aku lebih suka ada di dalam perlindungan Allah. Pergilah kau ke depan masjid umumkanlah bahwa kau sudah tidak lagi melindungi aku sebagaimana kau dulu mengumumkan perlindungan terhadapku. Lalumereka berdua pun pergi ke halaman masjid. Walid berkata, ini adalah Utsman, dia datang menemuiku untuk membebaskan dirinya dari perlindunganku. Utsman menanggapi pernyataan Walid dengan menyatakan: “Benar yang diucapkan Walid. Dia betul orang yang selama ini bertanggung jawab melindungiku, tetapi aku lebih suka untuk dilindungi oleh Allah dan aku tidak pernah sudi lagi untuk dilindungi oleh orang-orang yang dibenci oleh Allah SWT
.
Dapat kitaambil pelajaran bahwa Utsman sempat mengambil langkah yang kurang tepat, karena sesungguhnya yang tepat sebagai pelindung hanyalah Allah SWT. Karenanya ketika turun ayat 255 surah Al Baqarah, Rasul Saw segera memerintahkan kepada para sahabat yang selama ini menjadi pengawal Rasul: “Wahai saudara-saudaraku, pergilah kalian sekarang jangan lagi kalian mengawalku karena sudah ada yang mengawalku, Allah SWT”
.
Usai proses pelepasan perlindungan dari Walid, beliau menghadiri sebuah majelis orang-orang Quraisy yang sedang dipimpin oleh Lubaid bin Rabi’ah. Di dalam majelis tersebut, Lubaid bin Rabi’ah berkata: “Bukankah segala sesuatu selain Allah itu adalah hampa tidak ada nilainya sama sekali di sisi Allah?”. Kata Utsman:”Benar, apa yang kau katakan wahai Lubaid. Kata Lubaid pula: “Bukankah setiap kenikmatan suatu saat akan sirna”. Utsman menimpali pernyataan Lubaid:”Bohong, nikmat syurga tidak akan pernah sirna selama-lamanya, semua kenikmatandunia benar akan sirna tapi ada kenikmatan syurga yang tidak kalian yakini, tidak akan sirna selama-lamanya. Lubaid merasa terpotong dan terhina dengan ungkapan tersebut, padahal ia seorang tokoh Quraisy yang disegani. Lalu ia mengatakan: “Wahai kaum Quraisy, demi tuhan pernahkah kalian meliha seseorang menghinaku dalam majelis seperti ini?”. Salah seorang yang hadir di dalam majelis mengatkan:”Orang yang baru bicara ini adalah orang tolol yng baru saja meninggalkan agama nenek moyang kita, maka jangan digubris ucapannya”
.
Sejarah berulang, setiap orang yang akan kembali menegakkan ajaran Allah disebut tolol, bodoh atau idiot oleh orang-orangsesat. Padahal, yang bodoh menurut Allah adalah mereka yang tersirat dan tersurat dalam ayat 179 surah Al A’raaf, yang diantaranya adalah mereka yang memiliki akal namun tidak dipergunakan untuk berfikir di jalan Allah SWT. Utsman bin Mamh’un, menanggapi pernyataan orang tersebut sehingga terjadilah perang mulut di antara mereka, yang bersangkutan lalu berdiri dan memukul salah satu mata Utsman
.
Melihat kejadian tersebut, Walid bin Mughirah berkata :”demi tuhan wahai keponakanku, jika matamu itu kebal, kau pantas untuk melepaskan tanggungan dariku, tapi kau sudah melepaskan tanggungan itu maka aku tidak akan membelamu. Utsman berkata: “Demi Allah, sesungguhnya mataku yang satu lagi sangat membutuhkan apa yang dialami oleh mataku yang sebelah  karena dianiaya di jalan Allah. Walid berkata: “Jika kau mau, aku masih siap untuk menjadi pelindungmu. Jawab Utsman: “Tidak, tidak untuk selama-lamanya!”
.
Pergilah Utsman dengan sebelah matanya yang sakit, tetapi ia begitu luar biasa terbebas jiwanya karena ia sekarang sedang berlindung kepada Allah SWT. Suatu ketika, Rasul memerintahkan para sahabat untuk hijrah ke Medinah dan termasuklah diataranya Utsman. Di Medinah mereka bisa merasakan kekhusyuan beribadah dan kembali kesucian pribadi Utsman nampak kembali tergambar dalam hidup kesehariannya. Ia menjadi “Rahib” (orang suci) yang menghabiskan malamnya untuk beribadah dan siangnya bekerja keras, lalu terkadang malam dan siang dipakai untuk beribadah atau malam dan siang untuk berjuang termasuk berperang menghadapi orang-orang musyirikin.
utsman punya keistimewaan tersendiri dalam ber-“Zuhud”, hidupnya benar-benar-benar jauh dari kenikmatan dunia, beliau lebih suka memakai pakaian yang kasar dan tidak mengganti pakaian dan beliau tidak makan, kecuali makanan yang sangat sederhana. Pada suatu saat beliau masuk ke dalam masjid yang saat itu Rasul dan para sahabat sedang duduk-duduk, beliau masuk dengan memakai pakaian yang sangat tidak layak dipakai, melihat kondisi beliau, Rasul pun tersentuh hatinya, sementara para sahabat yang menyaksikan malah mengalirkan air mata. Beliau beribadah ternyata bukan hanya dengan meninggalkan kenikmatan dunia dalam arti makan, minum dan berpakaian, tapi pernah juga berniat untuk menjauhi istrinya. Ketika berita ini sampai kepada Rasul, maka Rasul mun menegur beliau dengan mengatakan: “Istrimu punya hak darimu”
.
Keinginan beliau senantiasa ber-“Mujahadah” inilah yang membuat Rasul sangat mencintai beliau. Karena ketika ruhnya yang suci hendak meninggalkan jasad menuju ke hadirat Allah SWT, Rasul pun berada disampingnya mendampingi sampai akhir hayatnya. Dan ketika utsman bin Mazh’un akhirnya meninggalkan alam dunia ini, Rasul menundukkan kepalanya dan mencium kening memenuhi wajah Utsman dengan air mata. Dengan iringan doa beliau; “Semoga Allah merahmatimu, wahai Utsman, kau tinggalkan alam dunia ini tidak pernah kau ambil sedikitpun keuntungan darinya, dan dunia pun tidak pernah dirugikan oleh sebab kehadiranmu”
.
Rasul tidak pernah melupakan orang yang sangat dicintainya, sepeninggal Utsman beliau selalu ingat dan memujinya di depan para sahabt, sehingga diriwayatkan saat putri Rasul, Rukayah akan meninggal dunia, Rasul berkata kepada putrinya:”Temuilah segera di alam barzah (Utsman bin Mazh’un) orang yang sangat baik dan mulia di sisi Allah SWT”
.
Seandainya anda hendak bermaksud menyusun daftar nama-nama sahabat yang Rasulullah saw. menurut urutan masa masuknya kedalam agama islam, maka pada urutan ke empat belas tentulah anda akan tempatkan Utsman bin Mazh’un.Tatkala agama islam cahayanya mulai menyinar dari kalbu Rasulullah saw dan dari ucapan-ucapan yang disampaikanya dari beberapa majelis, baik secara diam-diam maupun terang-terangan, maka Utsman bin Mazh’un adalah salah seorang dari beberapa segelincir manusia yang segera menerima panggilan Ilahi dan menggabungkan diri dari sekelompok Rasulullah.Seperti biasanya pengikut Rasulullah selalu diterpa berbagai derita dan siksaan pada saat itu.Rasulullah saw. mengutamakan keselamatan golongan kecil dari orang beriman dan teraniaya ini, dengan jalan menyuruh mereka berhijrah ke Habsyi. Dan Utsman bin Mazh’un terpilih sebagai pemimpin rombongan pertama dari Muhajirin ini. dengan putranya yang bernama Saib, dilangkahkanya kaki ke suatu negeri yang jauh menghindar dari tiap daya musuh Rasulullah dari Abu Jahal dan orang Quraisy.Dan ketika mereka berada di Habsyi, di sana mereka menghadapi suatu agama yang teratur dan tersebar luas, mempunyai gereja-gereja, rahib-rahib dan para pendeta. Dan tentulah orang-orang gereja di negeri Habsyi itu telah berusaha sekuat daya untuk menarik orang-orang Muhajirin kedalam agama mereka, dan meyakinkan kebenaran agama Masehi. Tetapi para kaum Muhajirin tidak ada yang beranjak dari kecintaan mereka yang mendalam terhadap agama islam dan terhadap Muhammad Rasulullah.Demikianlah kaum Muhajirin tinggal di Habsyi dalam keadaan aman dan tentram. Mereka senantiasa beribadan kepada Allah dengan tekun dan mempelajari ayat-ayat al-Quran yang ada pada mereka. Tiba-tiba sampailah berita kepada mereka bahwa orang-orang Quraisy telah menganut agama islam dan mengikuti Rasulullah bersujud kepada Allah.Maka bangkitlah orang-orang Muhajirin mengemas barang-barang mereka, dan bagaikan terbang mereka berangkat ke Makah dibawa kerinduan dan didorong kecintaan pada kampung halaman. Tetapi baru saja mereka sampai di kota, ternyata  masuknya orang-orang Quraisy itu hanya dusta belaka.Ketika itu mereka amat terpukul karena telah berlaku ceroboh dan amat tergesa-gesa. Tetapi betapa mereka akan kembali, padahal kota mereka telah berada di hadapan mereka. Dalam keadaan itu orang-orang musyrik di kota mekah telah mendengar  datangnya buronan yang telah lama mereka kejar-kejar dan pasang perangkap untuk menangkapnya.Perlindungan, ketika itu merupakan suatu tradisi di antara tradisi-tradisi arab yang memiliki kekudusan dan dihormati. Sekiranya ada seorang yang lemah yang beruntung masuk dalam perlindungan pemuka Quraisy, maka ia akan berada dalam suatu pertahanan yang kokoh. Diantaranya yang termasuk mendapat perlindungan adalah Utsman bin Mazh’un yang berada dalam perlindungan Walid bin Mughirah.Dalam keadaan itu, ia melihat saudara-saudara yang lain mendapat siksaan oleh kaum Quraisy yang keji, maka hatinya bergejolak, maka ia bermaksud untuk menanggalkan perlindunganya.Ia pun berkata kepada Walid bin Mughirah:“wahai Abu Abdi Syam, cukup sudah perlindungan anda, dan sekarang ini saya melepaskan diri dari perlindungan anda.”“kenapa wahai keponakanku?” ujar Walid, “mungkin ada seseorang anak buahku yang mengganggumu?”“tidak” jawab Utsman, ‘hanya saya ingin berlindung kepada Allah’.Maka Utsman pergi ke masjid dan mengumumkan penanggalan perlindunganya.Disana Utsman mendapatkan tinjuan tepat mengenai mata. Berkatalah Walid“wahai keponakanku, jika matamu kebal terhadap bahaya yang menimpa maka sungguh, benteng perlindunganmu sangat tangguh”.Ujar Utsman “tidak, bahkan mataku yang sehat ini amat pula membutuhkan pukulan yang telah dialami saudaranya dijalan Allah. Dan sungguh wahai Abu Syamas, saya berada dalam perlindungan Allah yang lebih kuat dan lebih mampu dari padamu.”
Dan setelah ditanggalkanya perlindungan dari Walid, maka Utsman menemui siksaan dari orang-orang Quraisy. Tetapi dengan begitu ia tidak merana, malah bahagia.Utsman melakukan hijrah ke madinah bersama rombongan sahabat-sahabat utama dengan keteguhan dan ketabahan hati mereka. Dan di kota hijrah Madinah al-Munawwarah itu bersingkaplah kepribadian dari Utsman bin Mazh’un tak ubah bagai batu permata yang telah diasah dan kebesaran hatinya yang istimewa. Ia memiliki ciri khas dalam zuhud dan ibadahnya. Ia amat tekun dan mencapai puncak tertinggi, hingga corak kehidupanya baik siang maupun malam dialihkanya menjadi sholat  yang terus menerus dan tasbih yang tiada henti.

Rupanya ia telah merasakan manisnya keasyikan beribadah itu, iapun hendak memutuskan hubungan dengan segala kesenangan dan kemewahan dunia. Ia tak hendak memakai pakaiaan kecuali yang kasar dan tak hendak memakan makanan selain yang amat bersahaja.,

Ibnu Mazh’un amat disayangi oleh rasulullah saw dan tatkala ruhnya yang suci itu berkemas-kemas hendak berangkat, hingga demikian ia merupakan orang Muhajirin yang pertama wafat di Madinah, dan yang mula-mula merintis jalan menuju surga, maka Rasulullah saw. berada disisinya.

Rasulullah saw. membungkuk, mencium kening Ibnu Mazh’un serta membasahi kedua pipinya dengan air yang berderai dari kedua mata beliau yang diliputi santun dan duka cita hingga saat kematiannya.

Dan bersabdah Rasulullah saw. melepas sahabat yang tercinta itu:

“semoga Allah memberimu rahmat wahai Abu Saib. Kamu pergi meninggalkan dunia, tak satupun keuntungan yang kamu peroleh dari padanya serta tak satu kerugianpun yang dideritanya daripada mu.”

Dan sepeninggalan sahabatnya, Rasulullah yang amat penyantun itu tidak pernah melupakanya, selalu ingat dan memujinya. Bahkan untuk melepas putri beliau Rukayah, yakni ketika nyawanya hendak melayang, adalah kata-kata berikut:

“pergilah susul pendahulu kita yang pilihan. Utsman bin Mazh’un”

Mush’ab bin ‘Umayr

Mush’ab bin ‘Umayr (Arabمصعب بن عمير) adalah salah seorang sahabat nabi Nabi Muhammad. Mush’ab berhasil memasukan ajaran Islam kepada Usayd bin Hudhayr dan sahabat Usayd yang bernama Sa’ad bin Mu’adz.

Biografi

Mus’ab bin Umair berasal dari keturunan bangsawan dari suku Quraisy. Ia adalah salah satu sahabat yang pertama dalam memeluk Islamsetelah Nabi Muhammad saw diangkat sebagai Nabi dan menyebarkan agama Islam.

Mus’ab bin Umair diutus oleh Nabi Muhammad saw untuk menyebarkan dan mengajarkan agama Islam di Madinah, setelah orang-orang dari Madinah datang menyatakan keislamannya. Ia di Madinah hingga Nabi Muhammad saw hijrah ke Madinah. Mus’ab bin Umair mati syahid diPertempuran Uhud.

Wisudawan Madrasah Rasulullah saw (ll)

Rasulullah saw mendo’akan Mash’ab bin Umair.

Berkenaan dengan Mash’ab, turun ayat Al-Qur’an Surat Al-Ahzab ayat 23, 

surat Al Ahzab ayat 23 :

مِنَ الْمُؤْمِنِينَ رِجَالٌ صَدَقُوا مَا عَاهَدُوا اللَّهَ عَلَيْهِ فَمِنْهُمْ مَنْ قَضَى نَحْبَهُ وَمِنْهُمْ مَنْ يَنْتَظِرُ وَمَا بَدَّلُوا تَبْدِيلًا

“Diantara orang-orang mukmin itu ada orang-orang yang menepati apa yang telah mereka janjikan kepada Allah; maka diantara mereka ada yang gugur . Dan diantara mereka ada (pula) yang menunggu-nunggu dan mereka sedikitpun tidak merubah (janjinya )”. (QS. Al Ahzab: 23)

Setiap kita sedang berjalan dalam rangka menepati janji kita kepada Allah. Diantara kita ada yang meninggal duluan, jika kita meninggal dalam berjuang dan menepati janji, maka itu adalah hal bagus dan indah. Ada diantara kita yang menunggu kapan matinya, dan itu tidaklah masalah, selama tidak merubah arah jalan kita dan tetap berpegang teguh pada komitnen dan tetap berjuang menepati janji itu.

.

Mash’ab pada suatu peristiwa  di PERANG BADAR berada di pihak Rasulullah SAW sementara keluarganya ada yang berada di pihak kemusyrikan. Turunlah QS. Mujadilah ayat 22.  Allah Subhanahu wata’ala berfirman :


لا تَجِدُ قَوْمًا يُؤْمِنُونَ بِاللَّهِ وَالْيَوْمِ الآخِرِ يُوَادُّونَ مَنْ حَادَّ اللَّهَ وَرَسُولَهُ وَلَوْ كَانُوا آبَاءَهُمْ أَوْ أَبْنَاءَهُمْ أَوْ إِخْوَانَهُمْ أَوْ عَشِيرَتَهُمْ أُولَئِكَ كَتَبَ فِي قُلُوبِهِمُ الإيمَانَ وَأَيَّدَهُمْ بِرُوحٍ مِنْهُ وَيُدْخِلُهُمْ جَنَّاتٍ تَجْرِي مِنْ تَحْتِهَا الأنْهَارُ خَالِدِينَ فِيهَا رَضِيَ اللَّهُ عَنْهُمْ وَرَضُوا عَنْهُ أُولَئِكَ حِزْبُ اللَّهِ أَلا إِنَّ حِزْبَ اللَّهِ هُمُ الْمُفْلِحُونَ

Artinya :

“Kamu tak akan mendapati kaum yang beriman pada Allah dan hari akhirat, saling berkasih-sayang dengan orang-orang yang menentang Allah dan Rasul-Nya, sekalipun orang-orang itu bapak-bapak, atau anak-anak atau saudara-saudara ataupun keluarga mereka. Meraka itulah orang-orang yang telah menanamkan keimanan dalam hati mereka dan menguatkan mereka dengan pertolongan yang datang daripada-Nya. Dan dimasukan-Nya mereka ke dalam surga yang mengalir di bawahnya sungai-sungai, mereka kekal di dalamnya. Allah ridha terhadap mereka, dan merekapun merasa puas terhadap (limpahan rahmat)-Nya. Mereka itulah golongan Allah. Ketahuilah, bahwa sesungguhnya hizbullah itu adalah golongan yang beruntung.”

Para sahabat yang lulus dari madrasah Rasulullah saw melaksanakan ajaran reformasi Rasul dalam kehidupan mereka dengan cara meninggalkan kesetiaan mereka kepada kelompok menuju kesetiaan kepada Islam.

Salah satu contoh yang paling baik untuk menjelaskan hal itu adalah Mash’ab bin Umair, salah seorang wisudawan madrasah Rasulullah. Riwayat singkatnya sebagai berikut; Bapaknya adalah Umair bin Hasyim bin Abdi Manaf bin Abdi Dar bin Qusyaiy bin Kilab. Dari jalur kakeknya, Mash’ab bersambung dengan Rasulullah saw.

Mash’ab bin Umair adalah seorang pemuda Mekkah yang terkenal sebagai remaja berwajah tampan, tegap, dan murah senyum. Dia termasuk Assâbiqun fîl Islâm. Ia bergelar Abu Muhammad sedangkan laqabnya adalah Mash’ab Al-Khair, Mash’ab Si Baik.

Mash’ab termasuk salah seorang yang hijrah ke Habsyi. Nabi saw mengutusnya sebagai mubaligh, mu’alim, dan mursyid ke Madinah. Berkat dakwah Mash’ab bin Umair, banyak kabilah Anshar yang masuk Islam. Dia ikut bersama Nabi dalam perang Badar. Pada perang Uhud, Nabi memberinya bendera pasukan dan ia pun gugur sebagai seorang syuhada di Perang Uhud

.
Ibnu Ishaq berkata, “Ketika kaum itu (orang-orang Madinah) hendak kembali, Rasulullah saw. mengutus Mush’ab bin ‘Umair agar menemani mereka. Dia diperintah Rasul agar membacakan al-Quran, mengajarkan Islam, dan memberi pemahaman agama kepada mereka.”

Setibanya di Madinah, beliau tinggal di rumah Sa’ad bin Zurarah. Selama di Madinah, kesehariannya diisi dengan mengajak para penduduknya untuk masuk Islam dan membacakan al-Quran kepada mereka secara door to door. Hasilnya, seorang demi seorang dari mereka bersyahadat.

Kesuksesan Mush’ab dalam mengislamkan penduduk Madinah bikin gerah Sa’ad bin Muadz, pemuka kaum bani ‘Abd al-Asyhal di Madinah. Sa’ad makin benci dengan Mush’ab ketika sepupunya, Usaid bin Hudhair, yang disuruh untuk menegur Mushab malah ikut masuk Islam. Sa’ad bergegas menemui Mushab. Di hadapan Mushab dan As’ad, Sa’ad ngomel-ngomel. Tapi apa respon Mushab?

“Ataukah Tuan berkenan duduk, lalu mendengarkan,” ajak Mush’ab pada Sa’ad dengan kata-kata yang halus. “Jika Tuan meridai perkara [yang hendak saya paparkan] ini dan Tuan menyukainya, Tuan bisa menerimanya. Jika Tuan membencinya, kami menyingkir darimu yang memang Tuan membencinya.”

“Ya, saya menerima. Itu adil,” jawab Sa’ad. Mush’ab menatapnya sejenak dengan muka manis, lalu memaparkan Islam dan membacakan al-Qur’an kepadanya. Sa’ad bertanya kepada keduanya, “Apa yang kalian lakukan ketika masuk Islam dan masuk agama ini?”

“Mandi dan sucikan diri dan pakainmu, kemudian bacalah kesaksian yang haq, lalu salatlah dua rakaat,” jelas Mush’ab dan As’ad.

Sa’ad berdiri, lalu mandi dan menyucikan pakaiannya, kemudian membaca syahadat dan salat dua rakaat, kemudian segera menuju kaumnya. Ketika sudah tiba Sa’ad berkata, “Ketahuilah! Sesungguhnya ucapan kaum pria dan wanita kalian terhadapku adalah haram hingga kalian beriman kepada Allah dan Rasul-Nya.”

Selang beberapa waktu, Mush’ab dan As’ad berkata, “Demi Allah, semenjak itu di rumah bani ‘Abd al-Asyhal tidak satupun laki-laki dan wanita kecuali muslim.”

Dalam waktu satu tahun, Mush’ab berhasil membalik kekufuran di Madinah, dari keberhalaan yang bodoh dan masya’ir (perasaan-perasaan) yang salah menjadi agama tauhid dan iman serta masya’ir Islam. Gimana dengan kita? Kita bisa seperti Mush’ab asal mau tetep semangat untuk ngaji dan dakwah. Oke?

Pada umumnya, orang-orang yang masuk Islam itu kebanyakan miskin, para mustadh’afin yang berasal dari keluarga sengsara, kecuali Mash’ab bin Umair. Mash’ab adalah anak seorang keluarga elit. Orang tuanya kaya raya. Ibunya sangat sayang kepadanya sehingga dia selalu diberi pakaian yang bagus-bagus dan indah-indah.

Ketika dia masuk Islam, ibunya marah-marah dan tidak mau menerimanya lagi. Mash’ab diusir dari rumahnya. Ibunya pun pernah mogok makan dan hanya mau makan bila Mash’ab bin Umair kembali lagi memeluk agamanya semula. Tetapi Mash’ab bin Umair bertahan dan akhirnya ibunya menghentikan mogok makannya. Mash’ab bin Umair sangat mencintai ibunya tetapi dia lebih mencintai Islam. Dia mendahulukan kesetia-an kepada Islam dari pada kesetiaan kepada keluarganya.

Umar bin Khathab meriwayatkan kisah Mash’ab dalam sebuah hadits sebagai berikut; “Pada suatu hari, Rasulullah saw melihat Mash’ab bin Umair di Madinah. Mash’ab datang dengan pakaian yang compang-camping, sebagian pakaiannya dijahit dari kulit domba. Rasul menangis, lalu ia bersabda kepada para sahabatnya, “Lihat, itu orang yang telah Allah sinari hatinya. Dahulu aku pernah melihatnya berada di tengah orang tuanya yang memberinya makanan yang lezat, minuman yang enak, dan pakaian yang bagus. Kemudian kecinta-an kepada Allah dan Rasul-Nya membawanya kepada keadaan yang kalian lihat.”

Mash’ab bin Umair diutus oleh Rasulullah saw sebagai mubaligh di Madinah, atas permintaan orang-orang Anshar pada Bai’at Aqabah yang pertama. Mash’ab berdakwah dengan senyuman. Rasulullah saw tahu, orang-orang Arab itu jarang ada yang ramah dan mereka sukar sekali untuk tersenyum. Sampai Nabi pernah mengingat-kan kepada mereka berkali-kali, “Senyum kepada saudaramu itu shadaqah.” Mash’ab bin Umair menaklukkan hati orang dengan senyuman dan keramahannya.

Berikut ini adalah kisah sebagian dakwahnya di Madinah; Orang yang pertama masuk Islam di tangan Mash’ab bin Umair adalah As’ad bin Jurarah. Mash’ab bin Umair tinggal bersamanya. Kedua orang itu men-datangi satu kabilah di kalangan penduduk Madinah yang sangat berpengaruh, untuk berdakwah. Pemimpin kabilah itu adalah Sa’ad bin Mu’adz dan Usaid bin Hudair.

Mereka masuk melalui dinding Bani Zhafar. Dulu, setiap kabilah membatasi kampungnya dengan dinding-dinding. Semacam benteng yang mempunyai pintu gerbang. Begitupun dengan kota-kotanya. Kedua pemimpin kabilah itu masih musyrik. Ketika mendengar kedatangan Mash’ab dan As’ad, Sa’ad bin Mu’adz berkata pada Usaid bin Hudair, “La aban laka, mudah-mudahan kamu tidak punya bapak. Berangkatlah kamu menemui kedua orang itu yang sudah mendatangi perkampungan kita dan menipu orang-orang bodoh di kalangan kita. Sekira-nya dia tidak datang bersama As’ad bin Jurarah dan sekiranya kamu bukan merupa-kan keluarga As’ad bin Jurarah, aku sudah bunuh dia.”

Usaid bin Hudair lalu mengambil tombaknya untuk menemui kadua mubaligh itu. Ketika As’ad bin Jurarah melihat dia, dia berkata kepada Mash’ab bin Umair, “Inilah pemimpin kaum datang, dakwahi dia kepada Islam.” Mash’ab menjawab, “Kalau dia duduk, aku akan bicara dengan dia.”

Begitu Usaid bin Hudair tiba, ia langsung memaki-maki Mash’ab bin Umair. Mash’ab hanya tersenyum menghadapi makian tersebut. Usaid memaki, “Mau apa kalian datang kepada kami ini lalu menipu orang-orang bodoh di antara kami. Pergi! Kalau kalian masih memerlukan nafas kalian.”

Mash’ab bin Umair berkata, “Bagai-mana kalau anda duduk sebentar. Kita ngobrol-ngobrol. Kalau Engkau senang, Engkau terima. Kalau engkau tidak senang, Engkau dijauhkan dari apa yang tidak Engkau senangi.” Orang itu luluh melihat kebaikan hati Mash’ab bin Umair. Dia berkata, “Engkau benar.”

Kemudian Usaid meletakkan tombak-nya dan duduk bersama mereka. Mash’ab bin Umair lalu menerangkan tentang Islam. Ia membaca Al-Qur’an. Ketika melihat Usaid bin Hudair mendengarkan dengan penuh perhati-an, kedua mubaligh itu berkata, “Demi Allah aku sudah melihat di wajahnya keislaman, sebelum dia berbicara dan menunjukkan keramahan.”

Usaid bin Hudair bertanya, “Alangkah indahnya pembicaraan kamu itu. Kalau ada orang yang mau masuk Islam bagaimana caranya?” Keduanya berkata kepada Usaid, “Engkau mandi. Engkau bersuci. Bersihkan kedua pakaianmu, kemudian Engkau meng-ucapkan kalimat syahadat, setelah itu, Engkau shalat.”

Akhirnya Usaid bin Hudair berdiri. Ia mandi, membersihkan pakaiannya, kemudian dia mengucapkan syahadat dan salat dua rakaat. Usaid, yang diutus oleh kawannya Sa’ad bin Mu’adz untuk megusir mereka itu, malah masuk Islam dan berkata, “Sesungguh-nya di belakangku ada seorang tokoh. Jika tokoh itu ikut kepadamu, tidak ada seorang pun di antara kaumnya yang akan membatah-nya. Aku akan utus dia untuk menemui kamu sekarang, Sa’ad bin Mu’adz namanya.”

Usaid mengambil lagi tombaknya dan pergi menemui Sa’ad bin Mu’adz beserta kaumnya. Sa’ad sedang duduk di tengah-tengah kabilahnya. Ketika melihat Usaid datang, Sa’ad berkata, “Demi Allah! Usaid telah datang dengan wajah yang yang berbeda daripada ketika ia pergi tadi.” Saat Usaid duduk di tengah kelompok itu, Sa’ad bertanya kepadanya, “Apa yang terjadi?” Usaid pun menjawab, “Aku sudah berbicara dengan kedua orang itu. Dan Demi Allah, aku tidak melihat niat yang buruk pada mereka. Aku larang mereka untuk menemui kita, tapi mereka berkata, ‘Aku akan lakukan apa yang kalian kehendaki. Namun aku dengar Bani Haritsah sudah keluar untuk membunuh Ibnu Jurarah. Mereka tahu bahwa anak bibimu itu akan menyerang kamu, karena itu mereka akan membunuhnya’.”

Sa’ad bin Mu’adz marah. Usaid membohongi Sa’ad, supaya Sa’ad marah dan menemui Ibnu Jurarah karena kuatir Ibnu Jurarah akan diserang oleh Bani Haritsah. Sa’ad mengambil tombaknya, kemudian pergi menemui Mash’ab dan As’ad. Ketika Sa’ad melihat keduanya dalam keadaan tenang. Tahulah Sa’ad bahwa Usaid hanya mendorong dia supaya mendengarkan pembicaraan mereka.

Sa’ad berdiri dan memaki-maki. Seperti biasa, Mash’ab membalasnya dengan senyuman. Dia berkata kepada Asad bin Jurarah, “Yâ Abâ Umamah, sekiranya di antara kita ini tidak ada hubungan kekeluar-gaan, aku tidak akan sampai pada keadaan seperti sekarang ini.” Lalu Asad berkata kepada Mash’ab, “Ini sudah datang pemimpin yang diikuti oleh seluruh kaumnya di belakang. Jika ia mengikutimu, tidak seorang pun di antara kaumnya yang akan mem-bantahnya.”

Mash’ab dengan ramah mengajaknya duduk dan mendengarkan pembicaraannya. Sama seperti kepada Usaid, ia berkata, “Kalau engkau suka, engkau terimalah pembicaraan-ku. Tapi kalau engkau tidak suka, tinggalkan-lah apa yang tidak engkau sukai.” Kemudian Mash’ab pun duduk membaca Al-Qur’an. Singkat cerita, karena keramahan Mash’ab, Sa’ad bin Mu’adz akhirnya masuk Islam.

Dalam Bahasa Parsi, wajah yang ramah disebut hulu adapun wajah yang menakutkan disebut lulu. Saya pernah mendengar sebuah puisi Parsi sebagai berikut, “Orang-orang ‘Irfan memperkenalkan agama dengan hulu. Sedangkan para Fuqaha memperkenalkan agama dengan lulu.” Mash’ab bin Umair adalah orang yang memperkenalkan agama dengan wajah yang ramah. Orang yang mencaci maki tidak dilawan cacian dan makian. Malahan ia tersenyum, seakan-akan ia menikmati cacian itu. Dengan keramahannya, luluhlah hati orang-orang Anshar itu.

Usaid bin Hudair dan Sa’ad bin Mu’adz lalu menemui kaumnya. Sa’ad berkata kepada kaumnya, “Ya Bani Abdil Asyhal, bagaimana menurut kalian urusanku di tengah-tengah kalian?” Kaumnya menjawab, “Engkau adalah pemimpin kami yang paling akrab diantara kami. Yang paling bagus pemikirannya. Kau adalah pemimpin yang paling bisa dipercaya.” Kemudian Sa’ad berkata, “Ketahuilah mulai saat ini, kalian, baik laki-laki maupun perempuan, haram berbicara denganku sebelum kalian beriman kepada Allah dan Rasul-Nya.” Sa’ad ber-maksud untuk memutuskan hubungan tribalisme itu.

Berkat bantuan kedua orang ini, akhirnya Mash’ab dan Asad mendatangi seluruh perkampungan Anshar. Sehingga tidak ada lagi di antara mereka yang tidak masuk Islam.
Kisah lain meriwayatkan Mash’ab pada suatu peristiwa di Perang Badar. Mash’ab bin Umair berada di pihak Rasulullah saw sementara keluarganya berada di pihak Musyrikin.
Seperti kita ketahui, pada Perang Badar orang Islam memetik kemenangan. Di antara tawanan yang berada di tangan kaum Muslimin adalah saudara Mash’ab bernama Abu Aziz Ibnu Umair. Mash’ab melewatinya dan melihat saudaranya tertawan. Abu Aziz adalah pemegang bendera Kaum Musyrikin. Ketika saudaranya menegur dan meminta pertolongannya, Mash’ab bin Umair berbicara kepada orang Anshar yang menawan saudara-nya, “Pegang tawanan ini kuat-kuat. Ibunya orang kaya. Mudah-mudahan ibunya bisa menebus dia dengan harga yang mahal”.

“Saudaraku, apakah ini nasihatmu kepadaku?” tanya saudaranya kebingungan. Mash’ab berkata kepada Abu Aziz sambil menunjuk orang Anshar yang menawannya, “Dia (orang Anshar) adalah saudaraku yang lebih dekat denganku dari pada kamu. Dia adalah saudaraku selainmu”.

Jadi, menurut Mash’ab, saudara seagama itu jauh lebih dekat dari pada saudara sedarah.
Tarikh yang saya kutip ini mengakhiri kisah Mash’ab bin Umair dengan Surat Hud ayat 46 yang mengisahkan Doa Nabi Nuh, ketika ia ingin menolong anaknya yang tenggelam. Nuh berdoa, “Tuhanku, ini anakku termasuk keluargaku. Dan janji-Mu benar, Engkaulah hakim yang paling bijaksana.” Lalu Tuhan berfirman, “Hai Nuh, dia bukan dari keluargamu. Dia adalah amal yang tidak shaleh. Dan janganlah kamu minta kepadaku yang kamu tidak punya ilmunya. Aku nasihati kamu supaya kamu tidak termasuk orang-orang yang jahil.”

.

Suatu saat Mush’ab dipilih Rasulullah untuk melakukan suatu tugas maha penting saat itu. Ia menjadi duta atau utusan Rasul ke Madinah untuk mengajarkan seluk beluk Agama kepada orang – orang Anshar yang telah beriman dan baiat kepada Rasulullah di bukti Aqabah. Disamping itu mengajak orang-orang lain untuk menganut agama Allah, serta mempersiapkan kota Madinah untuk menyambut hijratul Rasul sebagai peristiwa besar.

Sebenarnya di kalangan sahabat ketika itu masih banyak yang lebih tua, lebih berpengaruh dan lebih dekat hubungan kekeluargaannya dengan Rasulullah daripada Mush’ab. Tetapi Rasulullah menjatuhkan pilihannya kepada “Mush’ab yang baik”.  Dan bukan tidak menyadari sepenuhnya bahwa beliau telah memikulkan tugas amat penting ke atas pundak pemuda itu, dan menyerahkan kepadanya tanggung jawab nasib agama Islam di kota Madinah, suatu kota yang tak lama lagi akan menjadi kota tempatan atau kota hijrah, pusat dari dai dan dakwah, tempat berhimpunnya penyebar Agama dan pembela al-Islam.

Mush’ab memikul amanat itu dengan bekal karunia Allah kepadanya berupa fikiran yang cerdas dan budi yang luhur. Dengan sifat zuhud, kejujuran dan kesungguhan hati, ia berhasil melunakkan dan menawan hati penduduk Madinah hingga mereka berduyun-duyun masuk Islam.

Sesampainya di Madinah, didapatinya Kaum Muslimin di sana tidak lebih dari dua belas orang, yakni hanya orang-orang yang telah baiat di bukit Aqabah. Tetapi tiada sampai beberapa bulan kemudian, meningkatlah orang yang sama-sama memenuhi panggilan Allah dan Rasul-Nya.

Pada musim haji berikutnya dari perjanjian Aqabah, kaum muslimin Madinah mengirim perutusan yang mewakili mereka menemui Nabi. Dan perutusan itu dipimpin oleh guru mereka , oleh duta yang dikirim Nabi kepada mereka, yaitu Mush’ab bin Umair.

Dengan tindakannya yang tepat dan bijaksana, Mush’ab bin Umair telah membuktikan bahwa pilihan Rasulullah saw. atas dirinya itu tepat. Ia memahami tugas dengan sepenuhnya, hingga tak terlanjur melampaui batas yang telah ditetapkan. Ia sadar bahwa tugasnya adalah menyeru kepada Allah, menyampaikan berita gembira lahirnya suatu Agama yang mengajak manusia mencapai hidayah Allah, membimbing mereka ke jalan yang lurus. Akhlaqnya mengikuti pola hidup Rasulullah yang diimaninya, yang mengemban kewajiban hanya menyampaikan belaka.

Di Madinah Mush’ab tinggal sebagai tamu di rumah As’ad bin Zararah. Dengan didampingi As’ad, ia pergi mengunjungi kabilah -kabilah, rumah-rumah dan tempat-tempat pertemuan, untuk membacakan ayat-ayat Kitab Suci Allah, menyampaikan kalimatullah “bahwa Allah Tuhan Maha Esa” secara hati-hati.

Pernah ia menghadapi beberapa peristiwa yang mengancam keselamatan diri serta sahabatnya, yang nyaris celaka kalau tidak karena kecerdasan akal dan kebesaran jiwanya. Suatu hari, ketika ia sedang memberikan petuah kepada orang-orang, tiga-tiba disergap Usaid bin Hudlair kepala suku kabilah Abdul Asyhal di Madinah. Usaid menodong Mush’ab dengan menyentakkan lembingnya. Bukan main marah dan murkanya Usaid, menyaksikan Mush’ab yang dianggap akan mengacau dan menyelewengkan anak buahnya dari agama mereka, serta mengemukakan Tuhan Yang Maha Esa yang belum pernah mereka kenal dan dengar sebelum itu. Padahal menurut anggapan Usaid, tuhan-tuhan mereka yang bersimpuh lena di tempatnya masing-masing mudah dihubungi secara kongkrit. Jika seseorang memerlukan salah satu diantaranya, tentulah ia akan mengetahui tempatnya dan segera pergi mengunjunginya untuk memaparkan kesulitan serta menyampaikan permohonan. Demikianlah yang tergambar dan terbayang dalam fikiran suku Abdul Asyhal. Tetapi Tuhannya Muhammad saw. – yang diserukan beribadah kepada-Nya – oleh utusan yang datang kepada mereka itu, tiadalah yang mengetahui tempat-Nya dan tak seorangpun yang dapat melihat-Nya.

Demi dilihat kedatangan Usaid bin Hudlair yang murka bagaikan api sedang berkobar kepada orang-orang Islam yang duduk bersama Mush’ab, mereka pun merasa kecut dan takut. Tetapi “Mush’ab yang baik” tetap tinggal tenang dengan air muka yang tidak berubah.

Bagaikan singa hendak menerkam, Usaid berdiri di depan Mush’ab dan Sa’ad bin Zararah, bentaknya: “Apa maksud kalian datang ke kampung kami ini, apakah hendak membodohi rakyat kecil kami? Tinggalkan segera tempat ini, jika tak ingin segera nyawa kalian melayang!”

Seperti tenang dan mantapnya samudera dalam, laksana terang dan damainya cahaya fajar, terpancarlah ketulusan hati ”Mush’ab yang baik”, dan bergeraklah lidahnya mengeluarkan ucapan halus, katanya “Kenapa anda tidak duduk dan mendengarkan dulu? Seandainya anda menyukai nanti, anda dapat menerimanya. Sebaliknya jika tidak, kami akan menghentikan apa yang tidak anda sukai itu!”

Sebenarnya Usaid seorang berakal dan berfikiran sehat. Dan sekarang ini ia diajak oleh Mush’ab untuk berbicara dan meminta pertimbangan kepada hati nurani sendiri. Yang dimintanya hanyalah agar ia bersedia mendengarkan dan bukan lainnya. Jika ia menyetujui, ia akan membiarkan Mush’ab, dan jika tidak, maka Mush’ab berjanji akan meninggalkan kampung dan masyrakat mereka untuk mencari tempat dan masyarakat lain, dengan tidak merugikan ataupun dirugikan orang lain.

“Sekarang saya insaf”, ujar Usaid, lalu menjatuhkan lembingnya ke tanah dan duduk mendengarkan. Demi Mush’ab membacakan ayat-ayat Al-Quran dan mengajarkan dakwah yang dibawa oleh Muhammad bin Abdullah saw, maka dada Usaid pun mulai terbuka dan bercahaya, beralun berirama mengikuti naik turunnya suara serta meresapi keindahannya. Dan belum lagi Mush’ab selesai dari uraiannya. Usaidpun berseru kepadanya dan kepada sahabatnya, ”Alangkah indah dan benarnya ucapan itu! Dan apakah yang harus dilakukan oleh orang yang hendak masuk Agama ini?” Maka sebagai jawabannya gemuruhlah suara tahlil, serempak seakan hendak menggoncangkan bumi. Kemudian ujar Mush’ab, ”Hendaklah ia mensucikan diri, pakaian dan badannya, serta bersaksi bahwa tiada Tuhan yang haq diibadahi melainkan Allah”.

Beberapa lama Usaid meninggalkan mereka, kemudian kembali sambil memeras air dari rambutnya, lalu ia berdiri sambil menyatakan pengakuannya bahwa tiada Tuhan yang haq diibadahi melainkan Allah dan bahwa Muhammad itu utusan Allah.

Secepatnya berita itu pun tersiar. Keislaman Usaid disusul oleh kehadiran Sa’ad bin Mu’adz. dan setelah mendengarkan uraian Mush’ab, Sa’ad merasa puas dan masuk Islam pula.

Langkah ini disusul pula oleh Sa’ad bin Ubadah. Dan dengan keislaman mereka ini, berarti selesailah persoalan dengan berbagai suku yang ada di Madinah. Warga kota Madinah saling berdatangan dan tanya bertanya sesama mereka, “Jika Usain bin Hudlair, Saad bin ‘Ubadah dan Sa’ad bin Mu’adz telah masuk Islam, apalagi yang kita tunggu. Ayolah kita pergi kepada Mush’ab dan beriman bersamanya! Kata orang, kebenaran itu terpancar dari celah-celah giginya!”

—oo—

Demikian duta Rasulullah yang pertama telah mencapai hasil gemilang yang tiada taranya, suatu keberhasilan yang memang wajar dan layak diperolehnya. Hari-hari dan tahun-tahun pun berlalu, dan Rasulullah bersama para sahabatnya hijrah ke Madinah.

Orang-orang Quraisy semakin geram dengan dendamnya, mereka menyiapkan tenaga untuk melanjutkan tindakan kekerasan terhadap hamba-hamba Allah yang shalih. Terjadilah perang Badar dan kaum Quraisypun beroleh pelajaran pahit yang menghabisakan sisa-sisa fikiran sehat mereka, hingga mereka berusaha untuk menebus kekalahan. Kemudian datanglah giliran perang Uhud, dan Kaum Muslimin pun berisap-siap mengatur barisan. Rasulullah berdiri di tengah barisan itu, menatap setiap wajah orang beriman menyelidiki siapa yang sebaiknya membawa bendera. Maka terpanggilah “Mush’ab yang baik”, dan pahlawan itu tampil sebagai pembawa bendera.

Peperangan berkobar lalu berkecamuk dengan sengitnya. Pasukan panah melanggar tidak mentaati peraturan Rasulullah, merek meninggalkan kedudukannya di celah bukit setelah melihat orang-orang musyrik menderita kekalahan dan mengundurkan diri. Perbuatan mereka itu secepatnya merubah suasana, hingga kemenangan kaum muslimin beralih menjadi kekalahan.

Dengan tidak diduga pasukan berkuda Quraisy menyerbu Kaum Muslimin dari puncak bukit, atau tombak dan pedang pun berdentang bagaikan mengamuk, membatasi Kaum Muslimin yang tengah kacau balau. Melihat barisan Kaum Muslimin porak poranda, musuhpun menunjukkan serangan ke arah Rasulullah dengan maksud menghantamnya.

Mush’ab bi Umair menyadari suasana gawat ini, Maka diacungkannya bendera setinggi-tingginya dan bagaikan ngauman singa ia bertakbir sekeras-kerasnya, lalu maju ke muka, melompat, mengelak dan berputar lalu menerkam. Minatnya tertuju untuk menarik perhatian musuh kepadanya dan melupakan Rasulullah saw. dengan demikian dirinya pribadi bagaikan membentuk barisan tentara.

Sungguh, walaupun seorang diri, tetapi Mushab bertempur laksana pasukan tentara besar. Sebelah tangannya memegang bendera bagaikan tameng kesaktian, sedang yang sebelah lagi menebaskan pedang dengan matanya yang tajam. Tetapi musuh kian bertambah banyak juga, mereka hendak menyeberang yang menginjak tubuhnya untuk mencapai Rasulullah.

Sekarang marilah kita perhatikan saksi mata, yang akan menceritakan saat-saat terakhir kapahlawanan besar Mush’ab bin Umar.

Berkata Ibnu Sa’ad, “Diceritakan kepada kami oleh Ibrahim bin Muhammad bin Syurahbil al-‘Abdari dari bapaknya, ia berkata :

“Mush’ab bin Umair adalah pembawa bendera di Perang Uhud. Tatkala barisan Kaum Muslimin pecah, Mush’ab bertahan pada kedudukannya. Datanglah seseorang musuh berkuda, Ibnu Qumaiah namanya, lalu menebas tangan-nya hingga putus, sementara Mush’ab mengucapkan “Muhammad itu tiada lain hanyalah seorang Rasul” Maka dipegangnya bendera dengan tangan kirinya sambil membungkuk melindunginya. Musuhpun menebas tangan kirinya itu hingga putus pula. Mush’ab membungkuk ke arah bendera, lalu dengan kedua pangkal lengan meraih ke dada sambil mengucapkan, “Muhammad itu tiada lain hanyalah seorang Rasul, dan sebelumnya telah didahului oleh beberapa Rasul”. Lalu orang berkuda itu menyerangnya ketiga kali dengan tombak, dan menusukkannya hingga tombak itupun patah. Mush’ab pun gugur, dan bendera jatuh”.

Gugurlah Mush’ab dan jatuhlah bendera. ia gugur sebagai bintang dan mahkota para syuhada. Dan hal itu dialaminya setelah dengan keberanian luar biasa mengarungi kancah pengorbanan dan keimanan. Disaat itu Mush’ab berpendapat bahwa sekiranya ia gugur, tentulah jalan para pembunuh akan terbuka lebar menuju Rasulullah tanpa ada pembela yang akan mempertahankannya. Demi cintanya yang tiada terbatas kepada Rasulullah tanpa ada pembela yang akan mempertahankannya. Demi cintanya yang tiada terbatas kepada Rasulullah dan cemas memikirkan nasibnya nanti, ketika ia akan pergi berlalu, setiap kali pedang jatuh menerbangkan sebelah tangannya, dihiburnya dirinya dengan ucapan, “Muhammad itu tiada lain hanyalah seorang Rasul, dan sebelumnya telah didahului oleh beberapa Rasul”.

Kalimat yang kemudian dikukuhkan sebagai wahyu ini selalu diulang dan dibacanya sampai selesai, hingga akhirnya menjadi ayat Al-Quran yang selalu dibaca orang.

—oo—

Setelah pertempuran usai, ditemukanlah jasad pahlawan ulung yang syahid itu terbaring dengan wajah menelungkup ke tanah digenangi darahnya yang mulia. Dan seolah-olah tubuh yang telah kaku itu masih takut menyaksikan bila Rasulullah ditimpa bencana, maka disembunyikannya wajahnya agar tidak melihat peristiwa yang dikhawatirkan dan ditakutinya itu. Atau mungkin juga ia merasa malu karena telah gugur sebelum hatinya tenteram beroleh kepastian akan keselamatan Rasulullah, dan sebelum ia selesai menunaikan tugasnya dalam membela dan mempertahankan Rasulullah sampai berhasil.

Wahai Mush’ab cukuplah bagimu Ar-Raman.
Namamu harum semerbak dalam kehidupan.

—oo—

Rasulullah bersama para sahabat datang meninjau medan pertempuran untuk menyampaikan perpisahan kepada para syuhada. Ketika sampai ditempat terbaringnya jasad Mush’ab, bercucuran dengan deras air matanya. Berkata Khabbah ibnul ‘Urrat:

“Kami hijrah di jalan Allah bersama Rasulullah saw dengan mengharap keridlaan-Nya, hingga pastilah sudah pahala di sisi Allah. Diantara kami ada yang telah berlalu sebelum menikmati pahalanya di dunia ini sedikitpun juga. Diantaranya ialah Mush’ab bin Umair yang tewas di perang Uhud. Tak sehelaipun kain untuk menutupinya selain burdah. Andainya ditaruh diatas kepalanya, terbukalah kedua belah kakinya. Sebaliknya bila ditutupkan ke kakinya, terbukalah kepalanya. Maka sabda Rasulullah saw, “Tutupkanlah ke bagian kepalanya, dan kakinya tutupilah dengan rumput idzkhir!

Betapapun luka pedih dan duka yang dalam menimpa Rasulullah karena gugur pamanda Hamzah dan dirusak tubuhnya oleh orang-orang musyrik demikian rupa, hingga bercucurlah air mata Nabi. Dan betapapun penuhnya medan laga dengan mayat para sahabat dan kawan-kawannya, yang masing-masing mereka baginya merupakan panji-panji ketulusan, kesucian dan cahaya. Betapa juga semua itu, tapi Rasulullah tak melewatkan berhenti sejenak dekat jasad dutanya yang pertama, untuk melepas dan mengeluarkan isi hatinya. Memang, Rasulullah berdiri di depan Mush’ab bin Umair dengan pandangan mata yang pendek bagai menyelubungi dengan kesetiaan dan kasih sayang, dibacakannya ayat :


Diantara orang-orang Mu’min terdapat pahlawan-pahlawan yang telah menepati janjinya dengan Allah.

(Q.S. 33. Al-Ahzab : 23)

Kemudian dengan mengeluh memandangi burdah yang digunakan untuk kain tutupnya, seraya bersabda :

Ketika di Mekah dulu, tak seorangpun aku lihat yang lebih halus pakaiannya dan lebih rapi rambutnya dari padamu. Tetapi sekarang ini, dengan rambutmu yang kusut masi, hanya dibalut sehelai burdah.

Setelah melayangkan pandang, pandangan sayu ke arah medan serta para syuhada kawan-kawan Mush’ab yang tergeletak diatanya, Rasulullah berseru :

Sungguh Rasulullah akan menjadi saksi nanti di hari qiamat, bahwa tuan-tuan semua adalah syuhada disisi Allah

Kemudian sambil berpaling ke arah sahabat yang masih hidup, sabdanya,

Hai manusia! Berziarahlah dan berkunjunglah kepada mereka, serta ucapkanlah salam ! Demi Allah yang menguasai nyawaku, tak seorang Muslimpun sampai hari qiamat yang memberi salam kepada mereka, pasti mereka akan membalasnya.

Salam atasmu wahai Mush’ab…….
Salam atasmu sekalian, wahai para syuhada….

Mash’ab bin Umair lebih mencintai Islam dari pada keluarganya. Dia meninggal dunia pada perang Uhud dan Rasulullah saw pun menangisi kepergiannya.

Saya akhiri kisah Mash’ab bin Umair ini dengan satu peristiwa ketika Rasulullah saw pulang dari Uhud memasuki Madinah. Beliau disambut oleh perempuan-perempuan yang menangisi kematian keluarga mereka. Di antaranya ialah Zainab binti Jahasy. Begitu Rasulullah saw melihat Zainab, ia berkata, “Bersabarlah engkau Zainab.” Zainab ber-tanya, “Siapa yang meninggal itu, Ya Rasulullah?” “Saudaramu” jawab Rasul. “Inallilâhi wa inna ilayhi râji’ûn. Berbahagialah dengan syahadah yang telah dicapainya” jawab Zainab. Kemudian Rasulullah kembali berkata, “Bersabarlah engkau.” “Untuk siapa, Ya Rasulullah?” tanya Zainab. “Untuk Hamzah bin Abdul Muthalib,” jawab Rasul. Kembali Zainab berkata, “Innalillâhi wa inna ilayhi râji’ûn. Berbahagialah dengan syahadah yang telah dicapainya” Untuk ketiga kalinya, Rasulullah saw masih berkata, “Bersabarlah engkau, Hai Zainab” “Untuk siapa, Ya Rasulullah?” Zainab bertanya cemas. Rasul menjawab, “Untuk suamimu, Mash’ab bin Umair.” Barulah Zainab berteriak, “Duhai derita, duhai kesedihan!”

Ketika Mash’ab meninggal, dia masih memakai pakaiannya yang compang-camping itu. Rasulullah saw menangis dan berkata di hadapan jenazah Mash’ab, “Semoga Allah menyayangimu, Hai Mash’ab bin Umair. Aku sudah melihatmu di Mekkah dulu. Dan aku tak pernah melihat orang yang pakaiannya sebagus pakaian kamu. Yang kesenangannya sebaik kamu. Tapi sekarang, engkau dalam keadaan compang-camping dan tertutup debu”.
Rasulullah saw lalu menguburkan-nya. Saudara Mash’ab, Abu Rum, turun di kuburannya. Begitu juga Amir bin Rabiah Al-Anzi.

Rasulullah saw mendo’akan Mash’ab bin Umair. Berkenaan dengan Mash’ab, turun ayat Al-Qur’an Surat Al-Ahzab ayat 23, “Di antara orang-orang yang beriman itu ada orang yang membenarkan janji yang sudah mereka berikan kepada Allah”.

Itulah Mash’ab bin Umair, yang mendahulukan kesetiaan kepada Islam di atas kesetiaan kepada kelompoknya, kepada keluarganya, dan kepada suku bangsanya. Mash’ab bin Umair adalah contoh orang yang mendahulukan Islam dengan keramahan, dengan akhlak yang baik, dan dengan senyuman.

Dialah orang yang membawa Islam dengan Bunga Mawar, tapi tidak dengan durinya. Sementara banyak orang yang menyebarkan Mawar, tidak dengan menyebar-kan harumnya, melainkan durinya. Kalau kita sebarkan Islam dengan duri, kita akan banyak menyakiti orang. Tapi kalau kita sebarkan Islam dengan harumnya, Insya Allah, kita akan menarik mereka kepada Islam.

Ibnu Umar juga mengeluarkan hadits-hadits yang menyingkirkan Ali sebagai salah satu khalifah yang lurus. Kita tahu, Mu’awiyyah membunuh para sahabat seperti, Hujur bin ‘Adi, Syarik bin Syaddad, Shaifi bin Fasil, Asy-Syabani, Qabisyah bin Dhabi’ah Al-Abbasi, Mahraz bin Syahhab Al- Munqari, Kadam bin Hayyan Al-Anzi dan Abdurrahman bin Hassan Al-Anzi hanya karena tidak mau melaknat Ali. Abdurrahman Al-Anzi dikirim kepada Ziyad bin Abih dan dikuburkan hidup-hidup di Nathif dekat kuffah, ditepi sungai Efrat
.
Beranikah saudara-saudara peserta menganggap Mu’awiyyah dan seluruh pejabat, sahabat Rasulullah SAWW yang mendukungnya, serta para ulama telah kafir karena bukan saja memerintahkan kaum muslimin, termasuk para sahabat agar melaknat Ali, tetapi juga membunuh mereka yang menolak untuk melaknat? Pada masa itu tidak ada yang berani menamakan anaknya Ali. Sampai-sampai pernah seorang ayah melaporkan kepada penguasa karena merasa terhina oleh istrinya karena memanggilnya Ali!
.
Murtad atau kafir  bermakna : “mengkhianati janji setia atau meninggalkan wasiat atau membelot dari kesetiaan” dan tidak di artikan keluar dari agama islam (bukan kafir tulen, bukan murtad tulen).  Syiah meski memiliki beberapa kritikan terhadap para khalifah namun mereka tidak memandangnya sebagai orang murtad. Apabila pada sebagian riwayat Ahlusunnah terdapat penyandaran kemurtadan terhadap para sahabat Rasulullah Saw maka Syiah tidak memaknainya sebagai kemurtadan dalam pengertian teknis teologis.hadis tentang murtadnya para sahabat kecuali 3, 4 atau 7 hanyalah hadis yang bersifat situasional saja, bukan bersifat menyeluruh (fi’il madhi) . Penyebutan nama sahabat yang tidak murtad berjumlah 3, 4 atau 7 tidaklah dimaksudkan bahwa yang selain nama nama tersebut bukanlah Syi’ah Ali. Buktinya Nabi SAW memuji Hujr bin Adi, Zaid bin Arqam  dan Jabir bin Abdullah Al Ansari . Jadi membaca hadis syi’ah jangan sepotong sepotong. Syi’ah bukan golongan pen takfir seperti Khawarij. Syi’ah Ali memang hanya segelintir orang namun nama namanya  TiDAK TERBATAS UNTUK Di SEBUTKAN, bukan 3 – 4 atau 7. Jika ada orang yang beranggapan bahwa syi’ah Ali hanya berjumlah 7 orang maka orang tersebut SESAT MENYESATKAN karena menentang hadis hadis Nabi SAW
Hadis ini bersifat situasional ( fi’il madhi ), bukan bersifat  menyeluruh !!!

misal : Ayah anda wafat, lalu  adik kandung anda yang CEWEK  sedang  hamil , lalu datang  orang orang kampung  menyerbu rumah anda karena iri hati dengki  sehingga  adik  anda sakit lalu  keguguran.  Didalam  rumah  itu  ada  kawan  kawan  akrab  anda.. Lalu malam itu anda berkata  kepada kawan kawan  akrab  anda bahwa : “BESOK  BERKUMPULLAH disini, kita buat  PEMBALASAN”.. Nah, keesokan harinya yang datang  kerumah  anda  cuma  7  orang.. Salahkah jika anda berkata : “Yang patuh (tidak kafir) pada perintahku  cuma  7 orang saja ya, yang lain berbalik (murtad) dari perintahku” …

PERTANYAAN : Apakah kawan kawan  anda yang tidak berada  dalam rumah  tersebut juga bisa divonis  kafir dan  murtad  juga jika mendukung Imam Ali setelah peristiwa cukur rambut tersebut ???  YA  NGGAK LAH  akhi/ukhti  !!!

Pihak  syi’ah  tidak  pernah  membuat  i’tiqad  bahwa  hanya  3,4 atau 7  sahabat  yang  TiDAK  MURTAD..

Pihak  syi’ah  tidak  pernah  mengajarkan  i’tiqad  bahwa  hanya  3,4 atau 7  sahabat  yang  TiDAK  KAFiR..

Hadis  diatas bersifat  situasional  pada peristiwa itu saja…

Syiah di Indonesia Dalam Pergelaran Asy SyuraSyiah di Indonesia Dalam Pergelaran Asy Syura

Saqifah Bani Sa’idah

Bermula dari tragedi di Saqifah bani Sa’idah, semangat kesukuan di kalangan Anshar, antara Khazraj dan ‘Aus, yang pada masa Nabi bisa disatukan berpotensi bangkit kembali. Gelagat yang tidak sehat ini dapat dibaca oleh sayyidina Umar, maka ia mengajak sayyidina Abu Bakar dan Abu Ubaidah bin al-Jarrah untuk datang ke balairung tersebut. Silang sengketa pun semakin melebar menjadi perseteruan antara Muhajirin dan Anshar

.

Terjadilah dialog panjang yang pada akhirnya terpilihlah Abu Bakar sebagai khalifah pertama. Dari sinilah kemudian benih-benih penyelewengan sejarah umat Islam dimulai

.

Musuh-musuh Ahlulbait as. dan Syi’ah (pengikut setia) mereka tak henti-hentinya menaburkan fitnah beracun untuk memecah belah wahdatul Islam wal Muslimin/keutuhan Islam dan kesatuan barisan kaum Muslimin. Demi menyukseskan proyek besar musuh-musuh Islam, berbagai cara licik mereka tempuh agar terjadi benturan antara dua puak besar kaum Muslimin yaitu Ahlusunnah dan Syi’ah! Tuduhan demi tuduhan palsu tak henti-hentikinya mereka sebar-luaskan, mulai dari menuduh Syi’ah memiliki Al Qur’an sendiri dan tidak meyakini Al Qur’an kaum Muslimin hingga menuduh bahwa Syi’ah mengafirkan seluruh sahabat Nabi saw. kecuali segelintir saja dari mereka!
.
Untuk melengkapi tuduhan palsu semacam itu tidak jarang riwayat-riwayat tertentu mereka pelintir kandungannya atau bahkan teksnya mereka modifikasi agar mendukung kesimpulan mereka
.

Khusus terkait dengan tuduhan bahwa Syi’ah mengafirkan seluruh sahabat Nabi saw. kecuali segelintir orang saja, di mana atas dasar tuduhan palsu tersebut mereka membangun kesimpulan untuk menvonis kafir kaum Syi’ah!

.

Sementara itu, hadis-hadis serupa tentang kemurtadan para sahabat juga banyak diriwayatkan para ulama ahli hadis Ahlusunnah wal jama’ah. Lalu bagaimana para ahli hadis Sunni dapat dibebaskan dari vonis itu sementara muhaddis dan kaum Syi’ah divonis kafir?

.

Untuk menyingkat waktu kami akan sebutkan beberapa contoh hadis-hadis kemurtadan sahabat dalam riwayat Ahlusunnah dengan harapan mendapat jawaban dan arahan yang   ilmiah tentangnya

.

Syi’ah menyebutkan bahwa para sahabat Nabi semuanya murtad sepeninggal beliau kecuali hanya segelintir orang saja ???

Murtad atau kafir  bermakna : “mengkhianati janji setia atau meninggalkan wasiat atau membelot dari kesetiaan” dan tidak di artikan keluar dari agama islam (bukan kafir tulen, bukan murtad tulen)

Tentang Syi’ah kafirkan sahabat ??

Murtad atau kafir  bermakna : “mengkhianati janji setia atau meninggalkan wasiat atau membelot dari kesetiaan” dan tidak di artikan keluar dari agama islam (bukan kafir tulen, bukan murtad tulen).. Syi’ah menganggap mayoritas sahabat pasca wafat Nabi SAW tidak patuh, jadi hanya segelintir yang selamat di haudh.. Namun mayoritas sahabat Nabi SAW yang wafat masa Nabi SAW hidup mayoritas masuk surga..

Kafir dan Murtad yang dimaksudkan syi’ah bukan seperti kafirnya Abu Thalib versi Sunni, sama sekali tidak.. Syiah meski memiliki beberapa kritikan terhadap para khalifah namun mereka tidak memandangnya sebagai orang murtad. Apabila pada sebagian riwayat Ahlusunnah terdapat penyandaran kemurtadan terhadap para sahabat Rasulullah Saw maka Syiah tidak memaknainya sebagai kemurtadan dalam pengertian teknis teologis.

Kafir dan murtad versi syi’ah dapat diumpakan seperti kafir/murtad nya orang yang MALAS  SHALAT  FARDHU

Adapun sahabat Nabi SAW diluar yang 7 orang seperti Hujr bin Adi dll tetap dianggap ahli surga..

.

Rasulullah (Saw.) mengatakan bahawa majoriti sahabat telah menjadi murtad selepas kewafatannya (bukan kafir tulen, bukan murtad tulen tetapi tidak patuh pada wasiat), kerana mereka telah mengubah atau membatalkan hukum Allah dan Sunnah Rasulullah (Saw.). Hanya sedikit sahaja bilangan mereka terselamat. Syi‘ah tidak mengkafirkan mereka tetapi al-Bukhari dan Muslim telah mencatat di dalam Sahih Sahih mereka mengenai perkara tersebut.
.

Seperti  dalam hadis Imam Bukhari juga dari Ibnu Umar, ia mendengar Nabi saw. bersabda:

لاَ تَرْجِعُوْا بَعْدِى كُفَّارًا، يَضْرِبُ بَعْضُكُمْ رِقَابَ بَعْضٍ.

“Janganlah kamu kembali menjadi kafir sepeninggalku nanti, sebagian dari kamu menebas leher sebagian yang lain.”

Hadis yang sama juga diriwayatkan oleh Abu Bakrah, Jarir dan Ibnu Abbas dari Nabi saw. (Shahih Bukhari,9/63-64, Shahih Muslim, 1/58)

.
Shahih Bukhari,Hadits No.3100 :

3100. Telah bercerita kepada kami Muhammad bin Katsir telah mengabarkan kepada kami Sufyan telah bercerita kepada kami Al Mughirah bin an-Nu’man berkata telah bercerita kepadaku Sa’id bin Jubair dari Ibnu ‘Abbas radliallahu ‘anhuma dari Nabi shallallahu ‘alaihi wasallam bersabda: Sesungguhnya kalian akan dikumpulkan (pada hari qiyamat) dalam keadaan telanjang dan tidak dikhitan. Lalu Beliau membaca firman Allah QS al-Anbiya’ ayat 104 yang artinya (Sebagaimana Kami telah memulai penciptaan yang pertama, begitulah Kami akan mengulanginya. Itulah suatu janji yang pasti dari Kami. Sesungguhnya Kamilah yang akan melaksanakannya). Dan orang yang pertama kali diberikan pakaian pada hari qiyamat adalah Nabi Ibrahim ‘Alaihissalam dan ada segolongan orang dari sahabatku yang akan diculik dari arah kiri lalu aku katakan: Itu Sahabatku, Itu sahabatku. Maka Allah Ta’ala berfirman: Sesungguhnya mereka menjadi murtad sepeninggal kamu. Aku katakan sebagaimana ucapan hamba yang shalih (firman Allah dalam QS al-Maidah ayat 117 – 118 yang artinya (Dan aku menjadi saksi atas mereka selagi aku bersama mereka. Namun setelah Engkau mewafatkan aku…) hingga firman-Nya (….Engkau Maha Perkasa lagi Maha bijaksana)

.

.

.

.

.

Siapakah Sahabat Nabi yang murtad dalam Hadits ini?

Link sumber ambilan Hadits : http://bb.indoquran.com/en/hadith-bukhari/surah/42.html

Volume 4, Book 55, Number 568 :

Narrated by Ibn Abbas

The Prophet said, “You will be gathered (on the Day of Judgment), bare-footed, naked and not circumcised.” He then recited:–’As We began the first creation, We, shall repeat it: A Promise We have undertaken: Truly we shall do it.’ (21.104) He added, “The first to be dressed on the Day of Resurrection, will be Abraham, and some of my companions will be taken towards the left side (i.e. to the (Hell) Fire), and I will say: ‘My companions! My companions!’ It will be said: ‘They renegade from Islam after you left them.’ Then I will say as the Pious slave of Allah (i.e. Jesus) said. ‘And I was a witness Over them while I dwelt amongst them. When You took me up You were the Watcher over them, And You are a witness to all things. If You punish them. They are Your slaves And if You forgive them, Verily you, only You are the All-Mighty, the All-Wise.”(5.120-121)

Link sumber ambilan Hadits : http://www.sahih-bukhari.com/Pages/Bukhari_4_55.php

Narrated Ibn Abbas: The Prophet said, “You will be gathered (on the Day of Judgment), bare-footed, naked and not circumcised.” He then recited:–’As We began the first creation, We, shall repeat it: A Promise We have undertaken: Truly we shall do it.’ (21.104) He added, “The first to be dressed on the Day of Resurrection, will be Abraham, and some of my companions will be taken towards the left side (i.e. to the (Hell) Fire), and I will say: ‘My companions! My companions!’ It will be said: ‘They renegade from Islam after you left them.’ Then I will say as the Pious slave of Allah (i.e. Jesus) said. ‘And I was a witness Over them while I dwelt amongst them. When You took me up You were the Watcher over them, And You are a witness to all things. If You punish them. They are Your slaves And if You forgive them, Verily you, only You are the All-Mighty, the All-Wise.”(5.120-121)

Link sumber ambilan Hadits : http://www.searchtruth.com/book_display.php?book=55&translator=1&start=19&number=561

_______________________________________

Ternyata menurut Hadits yang ada dalam Shahih Bukhari ini,sepeninggal Rasulullah ada sekumpulan para Sahabat Rasulullah yang Murtad,karena di dalam Hadits ini Rasulullah memanggil mereka “Ashabi .. Ashabi (Sahabatku .. Sahabatku) kemudian dalam kalimat bahasa Arab di dalam Hadits ini memakai lafazh “Murtadina” yang berarti menunjukkan kepada kata Jamak atau banyak orang atau sekumpulan orang,dengan memakai lafazh jamak,itu menunjukkan bahwa sahabat Rasulullah yang murtad itu banyak,tidak satu orang.

Siapa sajakah para Sahabat Rasulullah yang murtad itu ?

Hadits ini ada di dalam kitab Shahih Bukhari dengan sanad dari Ibnu Abbas ra ,Kitab/Bab Para Nabi/Prophets. Jika umat Sunni dan umat agama Wahabi berani menuduh sesat Syi’ah karena Syi’ah berpendapat bahwa sebagian Sahabat Rasulullah ada yang murtad sepeninggal Rasulullah,beranikah umat Sunni dan umat agama Wahabi menuduh sesat Imam Bukhari dan Ibnu. Abbas ra ? karena ternyata Imam Bukhari dengan sanad dari Ibnu Abbas telah meriwayatkan bahwa ada segolongan Sahabat Rasulullah yang murtad sepeninggal Rasulullah.

Beranikah umat Sunni mengatakan Imam Bukhari dan Ibnu Abbas ra sesat ?

Beranikah umat agama Wahabi mengatakan Imam Bukhari dan Ibnu Abbas ra sesat ?

Mau menolak Hadits ini ? Atau mau menuduh ini Hadits palsu buatan Syi’ah ? Atau mau menuduh ini Hadits Palsu buatan Non-Muslim ?

Jangan buru-buru ,silahkan periksa dulu Kitab Shahih Bukhari yang ada di rumah kalian.

Mau mendhai’fkan Hadits ini ? Maaf,Hadits ini ada dalam Kitab Shahih Bukhari,Kitab Hadits paling Shahih no.1 menurut Sunni dan Wahabi. Jadi mutlak Shahih.

Silahkan berapologi wahai Sunni dan buatlah beribu alasan wahai umat agama Wahabi

Periksalah rumahmu sebelum mengatakan rumah orang lain kotor

“…. memberi peringatan kepada kaum yang bapak-bapak mereka belum pernah diberi peringatan, ….”(QS.Yasin:6)

Mereka mengatakan : “setelah Nabi Muhammad wafat semua sahabat murtad kecuali + 6 orang. (lihat Al ushul minal Kafi lil Kulaini 1/196-197, dan Kitab Kasyful Asror lil Khumaini hal. 155)”

wahai pembaca…

       Ahmad bin Muhammad bin Yahya daripada bapanya daripada Muhammad bin al-Husain daripada al-Hasan bin Mahbub daripada al-Harith beliau berkata: Aku telah mendengar Abd al-Malik bin A‘yan bertanya kepada Abu Abdullah a.s.   Abd al-Malik bertanya kepada Abu Abdullah a.s. sehingga dia berkata: Jika begitu, maka binasalah semua manusia? (halaka al-Nasu idhan?) Maka Abu Abdullah a.s berkata: Ya! Demi Allah, wahai Ibn A‘yan! semua manusia binasa (halaka al-Nasu ajma‘un). Abd al-Malik berkata: Semua penduduk Timur dan Barat? Beliau a.s menjawab: Ia telah terbuka kepada kesesatan. Demi Allah, mereka telah binasa (halaku) melainkan tiga orang iaitu (illa thalathata nafarin): Salman al-Farisi, Abu Dhar dan al-Miqdad. Setelah itu diikuti oleh ‘Ammar, Abu Sasan al-Ansari, Hudhaifah dan Abu ‘Amrah. Maka bilangan mereka bertambah menjadi tujuh orang”[Al-Kulaini, al-Raudhah, no.356, al-Kasyi,  al-Rijal, hal. 5,]
.
Dalam kitab Rijaalul-Kisysyi diriwayatkan dari Abu Ja’far bahwa ia berkata : “Para shahabat seluruhnya murtad kecuali tiga orang, yaitu Salman, Abu Dzarr, dan Al-Miqdad”. Aku bertanya,”Bagaimana dengan ‘Ammar bin Yasir?”. Ia menjawab,”Ammar telah melakukan satu penentangan kemudian ia kembali”. Abu Ja’far kembali melanjutkan perkataannya,”Jika yang engkau maksud adalah orang-orang yang tidak diragukan lagi dan tidak tercemar dengan sesuatu pun, maka ia adalah Al-Miqdad. Adapun Salman, merasuk ke dalam hatinya sesuatu keraguan bahwa Amirul-Mukminin (yaitu ‘Ali) disokong oleh Asma’ Allah Yang Maha Agung, sekiranya ia mengucapkannya niscaya bumi akan menenggelamkan mereka, seperti ini : “Ia memperagakannya dengan mengalungkan bajunya ke leher dan memukul lehernya dengan tangan dan pisau lalu dibiarkan tergantung seperti serigala. Lalu Amirul-Mukminin berpapasan dengannya lalu berkata,”Wahai Abu Abdillah, ini adalah balasannya, berbai’atlah!”. Maka Salma pun berbai’at. Adapun Abu Dzarr, Amirul-Mukminin memerintahkannya supaya diam. Namun, ia adalah orang yang tidak takut celaan orang dalam membela agama Allah, ia pun tidak mau mengikuti perintah beliau dan berbicara. Lalu ‘Utsman mencekal dan membuangnya. Kemudian orang-orang bertaubat setelah itu, orang pertama yang bertaubat adalah Abu Sasan Al-Anshari, Abu ‘Amrah, dan Syatirah. Total jumlahnya tujuh orang, tidak ada yang mengetahui hak Amirul-Mukminin kecuali tujuh orang tadi” (Rijaalul-Kisysyi 11-12).
.
       Daripadanya, daripada Muhammad bin al-Hasan, daripada Muhammad bin al-Hasan al-Saffar daripada Muhammad bin al-Husain daripada Musa bin Sa‘dan daripada Abdullah bin al-Qasim al-Hadhrami daripada ‘Umru bin Thabit berkata: Aku telah mendengar Abu Abdullah a.s berkata: Sesungguhnya selepas Nabi s.a.w wafat, maka orang ramai telah menjadi murtad melainkan tiga orang: Salman, al-Miqdad dan Abu Dhar. (Inna al-Nabi s.a.w lamma qubidha irtadda al-Nasu ‘ala a‘qabi-him kuffaran illa thalathan).Sesungguhnya apabila Rasulullah s.a.w wafat, maka empat puluh orang lelaki datang kepada Ali  bin Abu Talib a.s, Mereka berkata: Tidak, demi Allah! Kami tidak akan memberi ketaatan kepada sesiapapun melainkan anda. (la wallahi, la na‘ti ahadan ta‘atan ba‘da-ka abadan). Beliau a.s berkata: Kenapa? Mereka berkata: Sesungguhnya kami telah mendengar  Rasulullah s.a.w mengenai hak anda di hari Ghadir Khum. Beliau a.s berkata: Kamu semua akan melakukannya?. Mereka berkata: Ya. Beliau a.s berkata: Datang kepada aku esok dalam keadaan bercukur kepala (fa’tuuni ghadan muhalliqin). ‘Umru berkata: Tidak datang kepada Ali a.s. melainkan mereka bertiga. ‘Umru berkata: ‘Ammar bin Yasir datang kepada Ali a.s. selepas waktu Zuhur. Beliau a.s. memukul tangan  ke atas dadanya dan berkata kepada Ammar: Kenapa anda tidak bangkit daripada tidur kelalaian? Kembalilah kamu, kerana aku tidak memerlukan kamu yang tidak mentaati aku di dalam pencukuran  kepala. Bagaimana kamu mentaati aku untuk memerangi bukit besi!. Justeru kembalilah kamu, aku tidak memerlukan kamu (Irji‘u fa-la hajata li fi-kum antum lam tuti‘uni fi-halqi al-Ra’si fa-kaifa tuti‘uni fi qitali jibali  l-hadid)[Al-Majlisi,  Bihar al-Anwar, viii, 47, 51(Dikutip dari al-Ikhtisas, Syaikh Mufid)].

Jawaban pihak syi’ah :

Kronologis Asbabul Wurud hadis diatas dan maksud yang terkandung di dalamnya :

  1. Jenazah suci Rasulullah SAW belum dikebumikan, kaum Anshar suku Aus dan Khazraj berkumpul di Saqifah bani Sa’idah, info ini bocor kepada trio Abubakar – Umar dan Abu Ubaidah sehingga mereka bergerak cepat ke lokasi PERTEMUAN. Abubakar terpilih jadi Khalifah di Saqifah
  2. Setelah Imam Ali AS mengurus pemakaman Rasulullah, mengafani dan mengebumikannya maka malam harinya 40 orang berkumpul di rumah Imam Ali AS antara lain : Abbas bin Abdul Muthalib, Fadhl bin Abbas, Zubair bin Awwam, Khalid bin Sa’id, Miqdad Al Aswad, Salman Al Farisi, Abu Dzar Al Ghifari, ‘Ammar bin Yasir, Bara’ bin Anzib, Ubay bin Ka’ab dan lain lain BERTEKAD membai’at Imam Ali AS menjadi khalifah
  3. Umar bin Khattab mencium gerakan ini sehingga menyerbu rumah Fatimah untuk membakarnya jika kubu Imam Ali   tidak mau membai’at Abubakar. Abubakar  dan Umar  menyerbu rumah  Fatimah  dengan kekerasan  dengan tujuan  agar loyalis pendukung  Imam Ali  segera  membai’at  Abubakar secara paksa.. Sesuai dengan nukilan lugas dari Ahmad bin Hanbal dalam Musnad 1/55 dan Thabari 2/466 sebagian  kecil  sahabat  ini berkumpul di rumah Fatimah Zahra As dan menolak memberikan baiat kepada Abu Bakar
  4. Imam Ali AS diseret seret ke Masjid secara paksa, tetapi dihadang oleh Fatimah sehingga Abubakar meminta Umar menghentikan aksinya

.

Ibnu Abi Syaibah dan kitab “Al-Mushannaf:  Abu Bakar bin Abi Syaibah (159-235 H) pengarang kitab al-Mushannaf dengan sanad sahih menukil demikian:  “Tatkala orang-orang memberikan baiat kepada Abu Bakar, Ali dan Zubair berada di rumah Fatimah berbincang-bincang dan melakukan musyawarah. Hal ini terdengar oleh Umar bin Khattab. Ia pergi ke rumah Fatimah dan berkata, “Wahai putri Rasulullah, ayahmu merupakan orang yang paling terkasih bagi kami dan setelah Rasulullah adalah engkau. Namun demi Allah! Kecintaan ini tidak akan menjadi penghalang.  Apabila orang-orang berkumpul di rumahmu maka Aku akan perintahkan supaya rumahmu dibakar. Umar bin Khattab menyampaikan ucapan ini dan keluar. Tatkala Ali As dan Zubair kembali ke rumah, putri Rasulullah Saw menyampaikan hal ini kepada Ali As dan Zubair: Umar datang kepadaku dan bersumpah apabila kalian kembali berkumpul maka ia akan membakar rumah ini. Demi Allah! Apa yang ia sumpahkan akan dilakukannya!

.

Baladzuri dan kitab “Ansab al-Asyrâf: Ahmad bin Yahya Jabir Baghdadi Baladzuri (wafat 270) penulis masyhur dan sejarawan terkemuka, mengutip peristiwa sejarah ini dalam kitab “Ansab al-Asyrâf” sebagaimaan yang telah disebutkan.  Abu Bakar mencari Ali As untuk mengambil baiat darinya, namun Ali tidak memberikan baiat kepadanya. Kemudian Umar bergerak disertai dengan alat untuk membakar dan kemudian bertemu dengan Fatima di depan rumah. Fatimah berkata, “Wahai putra Khattab! Saya melihat kau ingin membakar rumahku? Umar berkata, “Iya. Perbuatan ini akan membantu pekerjaan yang untuknya ayahmu diutus.”

.

5.Umar bin Khattab memukul  perut Fatimah Az Zahra hingga keguguran dan sakit sakitan. Enam bulan kemudian puteri Nabi SAW ini wafat karena sakit akibat luka di penyerbuan tersebut

6. Setelah aksi penyerbuan bar bar ini selesai maka malam itu juga Imam Ali AS meminta kepada 40 orang yang berniat membai’at nya agar besok pagi datang lagi dengan BERCUKUR RAMBUT

Setelah  aksi  penyerbuan bar bar selesai, maka MALAM  iTU  JUGA Disebutkan dalam kitab sejarah bahwa Baginda Ali As dalam menjawab mereka yang berkumpul di rumahnya dan permintaan mereka untuk memberikan baiat kepadanya, “Besok pagi datanglah (kemari) dan cukurlah rambut kalian!” Akan tetapi keesokan harinya hanya tiga orang yang datang

7. Akan tetapi keesokan harinya hanya 3 orang yang datang BERCUKUR RAMBUT, yaitu

Salman Al Farisi (muhajirin)

Abu Dzar Al Ghifari (muhajirin)

Al Miqdad bin Aswad (muhajirin)

Adapun ‘Ammar bin Yasir telat datang sehingga ditegur keras oleh Imam Ali

Inilah  maksud  hadis hadis diatas !!!

Akan tetapi setelah itu dukungan kepada Imam Ali AS di ikuti oleh :

  1. ‘Ammar bin Yasir (muhajirin, diramalkan oleh Nabi SAW akan dibunuh oleh kelompok pemberontak)
  2. Abu Sasan Al Ansari
  3. Abu ‘Amrah
  4. Syatirah
  5. Hudhaifah

Jadi hadis tentang murtadnya para sahabat kecuali 3, 4 atau 7 hanyalah hadis yang bersifat situasional saja, bukan bersifat menyeluruh (fi’il madhi) . Penyebutan nama sahabat yang tidak murtad berjumlah 3, 4 atau 7 tidaklah dimaksudkan bahwa yang selain nama nama tersebut bukanlah Syi’ah Ali. Buktinya Nabi SAW memuji Hujr bin Adi, Zaid bin Arqam  dan Jabir bin Abdullah Al Ansari . Jadi membaca hadis syi’ah jangan sepotong sepotong. Syi’ah bukan golongan pen takfir seperti Khawarij. Syi’ah Ali memang hanya segelintir orang namun nama namanya  TiDAK TERBATAS UNTUK Di SEBUTKAN, bukan 3 – 4 atau 7. Jika ada orang yang beranggapan bahwa syi’ah Ali hanya berjumlah 7 orang maka orang tersebut SESAT MENYESATKAN karena menentang hadis hadis Nabi SAW

Dari segi tata bahasa Arab, murtad banyak maknanya tergantung apa kalimat setelah kata “murtadad/yartadid/murtadin”. Contoh :“MURTADDiNA ‘ALA A’QAABiHiM” artinya membelot dari janji mereka

Hadis ini bersifat situasional ( fi’il madhi ), bukan bersifat  menyeluruh !!!

misal : Ayah anda wafat, lalu  adik kandung anda yang CEWEK  sedang  hamil , lalu datang  orang orang kampung  menyerbu rumah anda karena iri hati dengki  sehingga  adik  anda sakit lalu  keguguran.  Didalam  rumah  itu  ada  kawan  kawan  akrab  anda.. Lalu malam itu anda berkata  kepada kawan kawan  akrab  anda bahwa : “BESOK  BERKUMPULLAH disini, kita buat  PEMBALASAN”.. Nah, keesokan harinya yang datang  kerumah  anda  cuma  7  orang.. Salahkah jika anda berkata : “Yang patuh (tidak kafir) pada perintahku  cuma  7 orang saja ya, yang lain berbalik (murtad) dari perintahku” …

PERTANYAAN : Apakah kawan kawan  anda yang tidak berada  dalam rumah  tersebut juga bisa divonis  kafir dan  murtad  juga jika mendukung Imam Ali setelah peristiwa cukur rambut tersebut ???  YA  NGGAK LAH  akhi/ukhti  !!!

Pihak  syi’ah  tidak  pernah  membuat  i’tiqad  bahwa  hanya  3,4 atau 7  sahabat  yang  TiDAK  MURTAD..

Pihak  syi’ah  tidak  pernah  mengajarkan  i’tiqad  bahwa  hanya  3,4 atau 7  sahabat  yang  TiDAK  KAFiR..

Hadis  diatas bersifat  situasional  pada peristiwa itu saja…

Syi’ah Ali merupakan golongan sahabat paling utama yang beriman dan mengorbankan seluruh diri mereka demi kepentingan Islam

Selama  40  hari  setelah  Nabi  SAW  wafat, Imam Ali AS dan Fatimah Az Zahra menghubungi pemuka pemuka di malam hari untuk mengingatkan mereka tentang perintah Nabi Muhammad SAW mengenai haknya atas kekhalifahan, mengajak mereka untuk bergabung dengannya menggalang kekuatan

Tetapi…

Hanya segelintir orang yang memberi tanggapan, selain nama nama diatas ada tambahan dukungan dari beberapa orang lainnya seperti :

  1. Khalid bin Sa’id bin Abil Ash (muhajirin, beliau menentang kepemimpinan Abubakar)
  2. Buraidah al Aslami (muhajirin, beliau menentang kepemimpinan Abubakar)
  3. Abul Haitsam bin Taihan (anshar, beliau menentang kepemimpinan Abubakar)
  4. Usman bin Hunaif (anshar, beliau menentang kepemimpinan Abubakar)
  5. Khuzaimah ibn Tsabit Al Anshari  (anshar, dikenal sebagai dzusy syahadatain karena kesaksian nya dianggap Nabi SAW sama dengan kesaksian dua orang, beliau menentang kepemimpinan Abubakar)
  6. Ubay bin Ka’ab (ANSHAR, beliau menentang kepemimpinan Abubakar)
  7. Abu Ayub Al Anshari (ANSHAR, beliau menentang kepemimpinan Abubakar)
  8. Jabir bin Abdillah Al Anshari (termasuk syi’ah Ali yang utama)

.

Syi’ah Ali memang hanya segelintir orang namun nama namanya TiDAK TERBATAS UNTUK Di SEBUTKAN, Syi’ah Ali juga termasuk :

  1.  Hujr bin Adi dan sahabat sahabatnya yang berjumlah tujuh orang (yang dibunuh   di ADZRA, mereka sudah diramalkan akan mati syahid oleh Nabi SAW jauh sebelumnya)
  2.  Zaid bin Arqam (sahabat yang dikatakan Nabi akan masuk surga tanpa hisab,  juga diramalkan Nabi akan buta di masa tuanya)
  3.  Malik al Asytar
  4.  Hasyim Al Mirqal
  5.  Sha’sha’ah bin Shuhan
  6.  Qais bin Sa’ad bin ‘Ubadah
  7.  Muhammad bin Abubakar
  8.  ‘Addi bin Hatim Al Tha’i
  9.  Uwais Al Qarni
  10. dan lain lain. Syi’ah Ali memang hanya segelintir orang namun nama namanya TiDAK TERBATAS UNTUK Di SEBUTKAN

.

Adapun Imam Ali, Fatimah, Hasan, Husain dan Bani Hasyim merupakan KERABAT NABi SAW dan bukan sahabat Nabi SAW.. Jadi Ibnu Abbas, Ibnu Mas’ud merupakan kerabat dalam makna hadis diatas dan bukan sahabat !!!

Pascawafatnya Rasulullah Saw, sebagian sahabat dalam banyak kasus telah mengusik dan menyakiti Fatimah Zahra As sehingga telah menyebabkan kekecewaan dan ketidakrelaan beliau. Sebagian dari kasus ini disebutkan dalam literatur-literatur Ahlusunnah

Ummu  Salamah  isteri  Nabi SAW merupakan isteri, bukan SAHABAT yang dimaksud hadis tersebut

Adapun dari PiHAK KERABAT yang tergolong yang tergolong syi’ah Ali antara lain adalah :

  1. Fatimah sang isteri tercinta
  2. Ibnu Abbas
  3. Abbas bin Abdul Muthalib
  4. Fadhl bin Abbas
  5. Hasan
  6. Husain
  7. Dll dari Bani Hasyim
  8. Ummu Salamah (janda Nabi SAW)

Yang dimaksud oleh hadis tersebut adalah : “selain 7 orang sahabat tersebut bukan berarti mereka kafir keluar dari Islam..

Murtad atau kafir yang mereka maksudkan bermakna : “mengkhianati janji setia atau meninggalkan wasiat atau membelot dari kesetiaan” dan tidak di artikan keluar dari agama islam

Ringkasnya Murtad/kafir disini bermakna : “murtad dari janji mereka dengan Rasul, bukan kafir tulen/murtad tulen dari Islam”

Demikian juga dalam sebuah riwayat yang dinukil dari Jabir bin Abdullah Anshari Ra disebutkan, “Pascawafatnya Rasulullah Saw, Hadhrat Fatimah Zahra jatuh sakit, dua orang sahabat Rasulullah Saw datang ingin membesuk dan menanyakan beliau! Hadhrat Fatimah Zahra Sa bersabda, ’Apakah kalian tidak mendengar Rasulullah Saw bersabda: Fatimah adalah belahan jiwaku. Barangsiapa yang menyakitinya sesungguhnya ia telah menyakiti aku? Dua orang sahabat itu berkata, ‘Iya. Kami mendengar darinya (Rasulullah).’ Saat itu, Hadhrat Fatimah Zahra Sa mengangkat kedua tangannnya ke atas dan berkata, ’Tuhanku. Engkau menjadi saksi bahwa kedua orang ini telah menyakitiku dan telah merampas hakku,’ kemudian beliau berpaling dari keduanya. Selepas itu beliau tidak berbicara dengan keduanya.”

Bahkan Umar dan Abubakar mengakui imamah Ali ! mereka mengakui pelantikan imam Ali di Ghadir Kum

Hanya saja di akhir hayat Nabi SAW : Abubakar, Umar cs adalah kelompok yang menginginkan kekuasaan, mereka bukan kafir tulen, bukan murtad tulen.. Demikian juga dengan kelompok khusus anshar yang ingin menguasai kembali Madinah setelah wafat Nabi SAW seperti Bin Ubadah mereka bukan kafir tulen, bukan murtad tulen…

Nabi SAW menyatakan kafir kepada sahabat yang berperang dengan sesamanya… Kafir disini bukan keluar dari Islam !!!

Dengan kondisi seperti ini sangat sulit bertindak, beliau harus tetap berdiam diri karena orang orang beriman yang sedikit ini akan terbunuh tanpa mereka bisa berbuat apa apa terhadap Islam

Perpecahan  diantara kaum muslimin bisa saja membumi hanguskan islam dari muka bumi ini. Oleh karenanya Imam Ali AS tidak bisa berbuat apa apa seperti yang dilakukan Nabi Harun AS untuk mencegah terjadinya perpecahan…

Bagaimana syi’ah memandang PARA SAHABAT ??

Adapun Abubakar dan Umar merupakan orang orang Islam tetapi perbuatan mereka tidak sungguh sungguh membela islam pasca Nabi SAW wafat

PERiSTiWA Saqifah menimbulkan BAHAYA YANG MENiMPA ISLAM di kemudian hari yakni UMAT MENJADi SESAT karena mendustakan, meninggalkan dan memusuhi ajaran ahlulbait. Teraniaya nya puteri + cucu Nabi dan tertahan haknya. Thaghut Umayyah Abbasiyah menindas para imam maksum lalu MERUBAH Hadis Hadis NABi, terampasnya warisan kepemimpinan ahlulbait penerus Nabi, Berkuasanya tiran fasik yang berlaku sewenang wenang kepada Ahlulbait dan syi’ah Ali sehingga mengalami ujian dan bencana tiada tara karena kezaliman pembangkang

POLiTiK KENEGARAAN MAZHAB SUNNi  (ahlusunnah waL jama’ah) MENYESATKAN  UMAT  DAN MUSTAHiL  TEGAK  KARENA  “SUNNAH  BUATAN “ SAHABAT  NABi SALiNG BERTENTANGAN

Pertikaian politik sering dicarikan legitimasi nya oleh Mazhab Sunni dengan memalsukan sumber sumber hadis dan kitab kitab sejarah. Kaum mu’tazilah tidak begitu banyak berpegang pada sunnah atau tradisi ahlul hadis sunni, bukan karena mereka tidak percaya pada tradisi Nabi SAW, tetapi karena mereka ragu akan keoriginalan hadis hadis sunni.

Syi’ah menyortir hadis sunni, karena syi’ah hanya mamu memakai sunnah yang betul betul asli (orisinal) dan bukan hadis hadis buatan yang bukan dari Nabi SAW

Wasiat Nabi SAW bahwa 12 khalifah Quraisy haruslah berasal dari Ahlul bait dan dari Bani Hasyim membuat mayoritas suku suku pasca Nabi SAW wafat tidak mau menerima. Mereka berpikir :  “Apakah kenabian dan kekhalifahan hanya hak eksklusif Bani Hasyim ???

Penolakan terhadap wasiat Nabi SAW tentang imamah wa khilafah sangat mengerikan karena kelak di kemudian hari mengakibatkan terjadinya PENYESATAN UMAT Muhammad SAW sepanjang masa, apalagi sunni mengedarkan doktrin politik nya dengan gaya gaya absolutistik dan merasa “pasti benar”.

PERiSTiWA Saqifah menimbulkan DAMPAK BERANTAi di kemudian hari yakni UMAT MENJADi SESAT karena mendustakan, meninggalkan dan memusuhi ajaran ahlulbait. Teraniaya nya puteri Nabi dan tertahan haknya. Thaghut Umayyah Abbasiyah menindas para imam maksum lalu MERUBAH Hadis Hadis NABi, terampasnya warisan kepemimpinan ahlulbait penerus Nabi, Berkuasanya tiran fasik yang berlaku sewenang wenang kepada Ahlulbait dan syi’ah Ali sehingga mengalami ujian dan bencana tiada tara karena kezaliman pembangkang

Allah SWT berfirman : “Wahai orang orang yang beriman, janganlah kamu mendahului Allah dan Rasul Nya. Bertakwalah kepada Allah” (Qs. Al Hujurat ayat 1)

Perpecahan, berbagai perselisihan, pertikaian dan propaganda yang tidak pada tempatnya mengakibatkan seseorang bisa menjadi MUSYRiK. Permusuhan membawa kepada kelemahan umat dan hilangnya wibawa !

Janganlah wahabi mengira definisi musyrik hanya dengan menyembah berhala, akan tetapi musyrik juga mencakup MEMECAH BELAH AGAMA dengan menjejalkan secara paksa berbagai kepentingan dan pandangan raja raja zalim kedalam agama  yang akhirnya melunturkan nilai keotentikan dan kesucian agama. Akibat nya hukum Allah menjadi keruh bercampur baur dengan tangan tangan kotor penguasa tiran.

Firman Allah SWT : “… janganlah kamu termasuk orang orang yang mempersekutukan Allah , yaitu orang orang yang memecah belah agama mereka dan mereka menjadi beberapa golongan. Tiap golongan merasa bangga dengan apa yang ada pada golongan mereka” (QS. Ar Rum ayat 31-32 )

Firman Allah SWT : “Apakah mereka mempunyai semabahan sembahan selain Allah yang mensyari’atkan untuk mereka agama yang tidak diizinkan Allah. Sekiranya tidak ada ketetapan yang menentukan (dari Allah) tentulah mereka telah dibinasakan . Dan sesungguhnya orang orang yang zalim itu akan memperoleh azab yang amat pedih” (Qs. Asy Syuraa ayat 21)

Misalnya : apa yang terjadi di Madinah selama jenazah Nabi SAW terbaring di kamar ‘Aisyah ?? Buku buku sejarah dikaburkan dengan polemik polemik sengit kaum sunni dengan penafsiran yang diselewengkan, bahkan dengan mengkafirkan dan membid’ahkan mazhab ahlul bait. Apakah tidakan keji ini membuat umat tidak sesat dikemudian hari ???

Perebutan kekuasaan menjadikan umat Islam terpecah belah. Syi’ah memerangi sektarianisme. Firman Allah SWT : “Sesungguhnya mereka yang memecah belah agama mereka kemudian menjadi bersekte sekte, engkau (Muhammad) tidak sedikitpun termasuk mereka” ( QS. Al An’am 169 ))

Tanyakan pada mereka : Apakah masuk akal pada bidang religius misalnya orang mengikuti Imam Malik lalu pada bidang politik mereka mengikuti KHALiFAH AL MANSHUR ???  Bukankah thaghut Umayyah dan thaghut Abbasiyah dikategorikan sebagai kelompok sunni ?

Mazhab Ahlusunnah Wal Jama’ah (sunni) menyatakan bahwa pemimpin sah dengan salah satu diantara empat cara perebutan kekuasaan :

  1. Sistem syura yang terbatas ( seperti pemilihan Abubakar )

Padahal sistem ini tidak lebih dari persekongkolan kalangan tertentu untuk merampas hak Imam Ali AS sebagai penerus tugas suci Nabi SAW

  1. Sistem istikhlaf ( penunjukan oleh khalifah sebelumnya seperti yang dilakukan Abubakar kepada Umar )
  2. Sistem syura dari dewan formatur yang ditunjuk khalifah sebelumnya ( seperti pengangkatan Usman bin Affan )
  3. Sistem al ghalabah bi as saif ( kemenangan perang /penaklukan dengan kekuatan militer seperti yang dilakukan Mu’awiyah yang menghunus pedang kepada Imam Ali AS), bahkan Sunni mengharuskan pentaatan pada penguasa yang zalim selama mereka masih shalat. Abdullah bin Umar menyatakan : “kami bersama orang yang berkuasa”

Apakah empat hal yang saling bertentangan seperti diatas bisa disatukan ??? Apakah sunnah Nabi yang otentik mengandung ajaran tersebut ?? Otak saya tidak bisa mencerna kontradiksi ini. Apalagi perbutan kekuasaan dengan meninggalkan jenazah Nabi, mencampakkan bani Hasyim, penindasan, berlaku sewenang wenang dan penumpahan darah terhadap manusia manusia MAKSUM dan para pengikutnya..

Sampai sampai khutbah jum’at pun dijadikan medan propaganda untuk membusukkan dan mengutuk Imam Ali AS. Apakah Sahabat Nabi SAW yang membenci Imam Ali dan keturunan nya bukan pendusta agama ??? Apakah Sahabat Nabi yang membunuh sahabat Nabi yang lain dan meracuni imam Hasan adalah adil ???

Perkongsian antara para SULTAN dan ulama kerajaan seperti Abu Hurairah menghasilkan SUNNAH REKAYASA bernama hadis hadis yang melarang rakyat berontak kepada penguasa zalim, hadis keadilan semua sahabat dan tidak adanya wasiat tentang  imamah Ali

Fatwa yang menyenangkan hati KANJENG PENGUASA akan mendapat pujian dan bintang tanda jasa dari Thaghut Umayyah – Abbasiyah, berduyun duyunlah ulama su’ mendekati istana dengan target menjual iman kepada pihak yang berkuasa !!

Sedangkan ulama yang berani berterus terang menyatakan ajaran islam yang sejati dihabisi karena Bani ‘Alawiyyah, orang orang yang pro Ali dan keturunannya dimusuhi thaghut Umayyah – Abbasiyah. Dituduh RAFiDHi. Rafidhi dikutuk dimana mana, ulama kerajaan berlomba lomba mengutuk rafidhi dalam kitab kitab nya. Apa saja kekeruhan dalam negara maka rafidhi yang salah, kalau ada kekacauan maka rafidhi punya ulah !!!

Mau dibawa kemana firman Allah SWT : “Dan janganlah kamu cenderung kepada orang orang yang zalim yang menyebabkan kamu disentuh api neraka, dan sekali kali kamu tiada mempunyai seorang penolong pun selain daripada Allah, kemudian kamu tidak akan diberi pertolongan ” (Qs. Huud : 113)

POLiTiK KENEGARAAN MAZHAB  SUNNi  (ahlusunnah waL jama’Ah) MENYESATKAN  UMAT  DAN MUSTAHiL  TEGAK  KARENA  SUNNAH  SAHABAT  NABi SALiNG BERTENTANGAN

Lalu bagaimana dengan mazhab syi’ah imamiyah selaku satu satunya mazhab yang selamat ??? 12 imam maksum syi’ah memegang hak kepemimpinan politik sekaligus menjadi rujukan dalam masalah masalah keagamaan sebagaimana yang dicontohkan Nabi SAW ketika menjadi Pemimpin Negara Madinah yang tidak memisahkan antara dunia dan akhirat..

Bukankah Nabi SAW tidak hanya berperan sebagai seorang Nabi pembawa wahyu, pengajar ilmu (guru), penjelas mana yang baik dan mana yang buruk, tetapi juga berperan sebagai pemimpin NEGARA…

Kepemimpinan syi’ah adalah amanah ke Tuhanan (divine trust) yang merangkumi urusan duniawi-ukhrawi dengan dwi peran utama yaitu memelihara agama dan mengurus dunia

Syi’ah tidak gentar karena kami berpedoman pada surat Ali Imran ayat 103 yang isi nya agar UMAT berpegang teguh kepada AGAMA ALLAH.

Adapun semua penindasan terhadap Fatimah, 12 imam maksum dan kaum syi’ah kami anggap sebagai cobaan dari Allah SWT. Firman Allah SWT : “Jika seandainya Allah menghendaki, maka pastilah Dia menjadikan kamu sekalian umat yang tunggal. Tetapi (Dia tidak menghendakinya) karena Dia hendak menguji kamu semua berkenaan dengan sesuatu yang diberikan Nya kepada mu” (Qs. Al Maidah ayat 51)

Firman Allah SWT : “Kalau seandainya Tuhan mu menghendaki, maka tentunya Dia jadikan manusia umat yang tunggal. Tetapi mereka itu akan tetap selalu berselisih, kecuali mereka yang mendapatkan rahmat dari Tuhanmu, dan untuk itulah Dia menciptakan mereka” (Qs. Huud 118-119)

Firman Allah : “Manusia tidak lain kecuali umat yang tunggal, kemudian mereka berselisih. Jika seandainya tidak karena adanya SABDA (kalimah) yang telah lewat dari Tuhan mu, maka tentulah diputuskan (sekarang juga) antara mereka berkenaan dengan perkara yang mereka perselisihkan itu” (Qs. Yunus 19)

Firman Allah : “Pada mulanya manusia adalah umat yang tunggal. Kemudian Allah mengutus para Nabi membawa berita gembira dan peringatan, dan Dia menurunkan bersama para Nabi itu Kitab suci dengan sebenarnya untuk memutuskan perkara antara umat manusia berkenaan dengan masalah yang mereka perselsihkan. Dan mereka yang menerima kitab suci itu tidaklah berselisih mengenai sesuatu kecuali setelah datang berbagai penjelasan, karena rasa permusuhan antara sesama mereka. Maka Allah pun dengan izin Nya memberi petunjuk tentang kebenaran yang mereka perselisihkan itu kepada mereka yang beriman. Allah memberi petunjuk kearah jalan yang lurus kepada siapa yang menghendakinya” (Qs. Al Baqarah 213)

Mazhab Sunni menghindari pembicaraan tentang tingkah laku negatif para SAHABAT sehingga mazhab syi’ah menjadi terpojok dituding sebagai pencela/pelaknat. Namun dalam hal ini syi’ah siap menyerahkan perselisihan ini di MAHKAMAH AKHiRAT kelak

Gerakan Syi’ah di Indonesia sudah sedemikian pesat

 

بسم الله الرحمن الرحيم

MEREKA YANG BERUSAHA MEMBELA SYI’AH
Indonesia memiliki umat Islam terbesar jumlahnya didunia dan meskipun tampak sebagai aliran Sunni tapi sebenarnya Islamnya sendiri masih abu-abu, tidak jelas.Mengapa Iran menganggap bahwa Islam di Indonesia masih abu-abu adalah karena kaum muslim di Indonesia itu sebenarnya tidak mengerti ajaran Islam yang sebenarnya, Islam di Indonesia sudah tercampur baur dengan budaya Indonesia – jadi sudah tidak murni lagi

.

Semoga Islam bisa berdamai sehingga tidak terjadi perpecahan. Cara satu-satunya adalah supaya setiap pemeluk diajarkan untuk saling menghargai perbedaan, memandang perbedaan sebagai bunga-bunga kehidupan. Mazhab baru seolah muncul kini yaitu Mazhab SUSi (sunni syi’ah), jadi damai lah

KH. Din Syamsuddin Ketua Umum Muhammadiyah Capres 2014

Ketua Umum Pengurus Besar Nahdlatul Ulama (PBNU) KH Said Aqil Siroj Capres 2014
……………………………..

Prof. Quraish Syihab

Alwi Syihab

KH. Hasyim Muzadi

M. Maftuh Basuni

Umar Shihab

Azyumardi Azra

Amien Rais

Gusdur

Ulil Abshar Abdala

Mahfud MD

Ahmad Syafi’i Ma’arif

.

GERAKAN ANTi SYI’AH di Indonesia didalangi Salafi wahabi dakwah dan Salafi wahabi jihadi 

Jika Syi’ah dilarang maka terorisme akan tumbuh subur..

.

Agama apakah yang  berkembang paling pesat di Eropa saat ini? Jawabannya tentu saja Islam. Ah, mana sih ada orang yang sampai tidak tahu? Bukan hanya sebatas di Eropa saja tapi Islam juga berkembang di hampir di seluruh dunia.

Kalau di Indonesia aliran apa yang maju pesat ??

Syi’ah Imamiyah itu masuk ke Indonesia setelah revolusi Iran 1979. Sampai 1993 pun Jalaluddin Rakhmat di Bandung yang sudah sangat dikenal oleh ulama Syi’ah seperti Syaikh Taskhiri di Iran,namun Jalal masih mengaku Susi, Sunnah-Syi’ah.

Belakangan, tahun 2000 kala Gus Dur jadi presiden barulah didirikan apa yang mereka sebut Ijabi (Ikatan Jama’ah Ahlul Bait Indonesia) dengan alasan mumpung presidennya Gus Dur.  Sedang penyiaran kesyi’ahannya dibungkus-bungkus lewat jalur tasawuf, baik lewat buku karangan, pendidikan, maupun pengajian. Di antaranya Jalaluddin merangkul anak bekas wakil Presiden di masa lalu untuk mengembangkan Syi’ah lewat tasawuf.

Orang-orang seperti Alwi Shihab, Quraish Shihab, Haidar Bagir dan semacamnya merupakan jalur yang sering orang sebut sebagai dekat dengan Syi’ah, hingga Quraish Shihab yang punya rubrik tanya jawab Agama Islam di koran Republika waktu lalu mengambil kesempatan untuk mengemukakan bahwa Sunni dengan Syi’ah hanya beda masalah politik.

Syi’ah menggunakan berbagai macam nama antara lain Ahlul Bait, Muthahhari, Muntazar, Mulla Shadra, Madinatul Ilmi, Babul Ilmi, dan sebagainya. Belakangan ada kelompok IJABI (Ikatan Jamaah Ahlul Bait Indonesia), ABI (Ahlul Bait Indonesia), dan ada juga apa yang disebut Muhsin. IJABI dan Muhsin dikhabarkan mengedarkan undangan peringatan Maulid Nabi, Februari 2012 di Jakarta dengan yang tercantum sebagai pembicara adalah Said Aqil Siradj dan Din Sayamsuddin, masinh-masing dikenal sebagai ketua umum NU (Nahdlatul Ulama dan Muhammadiyah).

Di Jawa Timur, gerakan Syi’ah cukup berkembang pesat. Mereka tergabung dalam IJABI (Ikatan Jamaah Ahlul Bait Indonesia). IJABI telah mendapatkan pengikut yang cukup banyak. Komunitas mereka tersebar di beberapa wilayah seperti Surabaya, Bangil, dan Malang.

Di Bangil, mereka memiliki pesantren sendiri yang diberi nama YAPI (Yayasan Pesantren Islam) al-Ma’hadul Islami. Pesantren YAPI memiliki dua kampus, untuk putra dan putri. Jenjang pendidikan SMP-SMA dengan metode boarding school atau pondokan. Segala macam ilmu Islam dipelajari di sini, terutama yang berhubungan dengan Syi’ah.

Di Surabaya, selain aktif menyelenggarakan kajian di rumah-rumah, dakwah IJABI juga merambah dunia perguruan tinggi. Seolah ingin melanjutkan kesuksesan lembaga pendidikan tingkat dasar dan menengah di Malang dan Bangil, mereka masuk ke kampus-kampus. Unair salah satunya.

Sekitar tahun 2000, IJABI mulai masuk Unair. Tidak sulit memang bagi Syi’ah masuk dunia perguruan tinggi, karena kebanyakan mereka dari kalangan akademisi dan intelektual. Di Unair pula IJABI mendirikan IIC (IJABI Intelektual Community), yang diketuai oleh Hery Abdillah. (Sabili, 3 Muharram 1429 H, halaman 24).

Di Medan didirikan markas Syi’ah pula beberapa tahun lalu, diketuai mahasiswa dari IAIN Medan. Peresmian markas aliran sesat itu, menurut seorang anggota MUI Medan, dengan menghadirkan petinggi Syi’ah dari Iran.

di Samarinda. Setelah mereka tampak sukses menghadirkan Quraish Shihab dari Jakarta maka acara di hotel diselenggarakan pada periode berikutnya dengan menghadirkan tokoh Syi’ah dari luar negeri.

.

Usamah bin Ladin Biayai Bom Bali 30.000 Dolar 

Usamah bin Ladin memberi lebih dari 200 juta rupiah atau 30.000 dolar Amerika untuk Bom Bali 2002, kata Muhammad Ihsan atau Idris Gembrot dalam persidangan Umar Patek hari ini (Senin 26/03) di Pengadilan Negeri Jakarta Barat.

“Uangnya dari Usamah,” kata Idris, seperti dikutip dari BeritaSatudan TheJakartaGlobe hari ini.

Uang itu menurut kesaksian Idris digunakan untuk membeli minibus Mitsubishi L300 yang digunakan untuk memuat bom. Selain untuk membeli mobil, dana dari Usamah itu menurut klaim Idris juga digunakan membeli dua sepeda motor, bahan-bahan membuat bom dan untuk biaya hidup saat merencanakan serangan di Paddys Club dan Sari Club di Legian, Bali.

Selain dana dari Usamah, menurut Idris yang menjadi saksi dalam persidangan Umar Patek hari ini mengatakan ada donatur lain, namun dirinya tidak mengetahui siapa donatur tersebut.

Idris merupakan mantan narapidana Bom Bali I yang divonis penjara 10 tahun, namun ia hanya menjalani hukuman beberapa tahun saja, setelah dianggap kooperatif dengan Densus 88 dan banyak memberikan informasi terkait jaringan terorisme di Indonesia.

munculnya gerakan atau usaha membela Syi’ah yang dilakukan oleh beberapa tokoh di Indonesia.

Sebagaimana kita ketahui, bahwa akhir akhir ini sejak kunjungan Presiden Iran ke Indonesia serta pertemuannya dengan beberapa tokoh Islam di Indonesia, gerakan membela Syi’ah mulai kelihatan. Rupany usaha tokoh tokoh Syi’ah di Indonesia dalam menggandeng tokoh tokoh kita mulai nampak hasilnya.

Sehingga ada yang dengan terang terangan membela Syi’ah seperti yang dilakukan oleh Said Agil Siraj. Begitu pula ada yang dengan semangat tinggi mengadakan pendekatan (Tagrib) antara Sunni dengan Syi’ah, seperti yang dilakukan Alwi Syihabdan Hasyim Muzadi dan yang lain di Bogor. Serta ada yang menulis buku, seperti yang dilakukan oleh Prof. Quraish Syihab.

Begitu pula komentar Said Agil Siraj yang mengatakan; “Muslimin di Indonesia yang dikenal sebagai Ahlussunnah sesungguhnya sudah menjadi Syiah minus Imamah”. (Kompas 13 Mei 2007).

M. Maftuh Basuni saat mengomentari Buku Quraisy Syihab tersebut, dimana beliau mengatakan;” Baik Sunni maupun Syiah punya dasar yang sama, jadi tidak perlu dipertentangkan “ (Kompas 13 Mei 2007)

Berkenalan Dengan Syiah di Indonesia


Beberapa kalangan menyebut penganut Syi’ah di Indonesia berbeda dengan di Iran dan Irak. Salah satu diantaranya Prof. Dr. Nur Syam, Rektor IAIN Sunan Ampel Surabaya, di harian SURYA sabtu (31/12/2011) mengatakan bahwa Syi’ah di Indonesia telah ‘mengindonesia’. Beradaptasi dengan kultur Indonesia. Benarkah demikian?

Dalam konteks ini, menarik jika kita membaca hasil penelitian disertasi Prof. Dr. Mohammad Baharun, M.Ag di IAIN Surabaya tentang karakter Syi’ah Indonesia. Menurut Rektor Universitas Nasional Pasim Bandung ini, Syi’ah di Indonesia itu tidak monolitik. Meski begitu, penelitian Prof. Baharun selama bertahun-tahun itu menyimpulkan, bahwa mereka disatukan oleh satu doktrin esensial, yakni doktrin Imamah.

Ternyata, faktor perbedaan karakter Syi’ah di Indonesia itu bukan karena budaya, kultur keindonesiaan. Akan tetapi, tingkat pemahaman penganut Syi’ah terhadap doktrin Imamah itu yang melahirkan tipologi yang berbeda. Adapun faktor budaya dan kultur Indonesia hanya mewarnai kulitnya saja, tidak sampai kepada mengubah pandangan akidah, atau doktrin-doktrin utamanya. Kesimpulannya, pada dasarnya Syi’ah di Indonesia itu menurut Prof. Baharun sama dengan Syi’ah di Iran yakni Syi’ah Istna ‘Istna Asyariyah. Apalagi, penyebarannya dibawa oleh orang-orang Indonesia alumni Universitas Qom Iran.

Doktrin Utama

Akidah yang paling sentral dan sifatnya mutlak dalam Syi’ah Itsna ‘Asyariyah adalah akidah Imamah. Mengimani dua belas Imam yang disebutnya ma’shum (bebas dari kesalahan), sebagaimana kema’shuman para Nabi. Dalam pengertian Syi’ah, Imammah ini bukan seperti Imamah dalam konsep Ahlus Sunnah wal Jama’ah. Akan tetapi imamah adalah doktrin primer dalam ideologi dan teologi.

Dalam pemahaman Ahlus Sunnah Imamah disebut pula khalifah, yaitu penguasa dan pemimpin tertinggi rakyat sesudah Nabi SAW. Kata imam pun disebut dalam al-Qur’an dengan berbagai bentuk, selain berarti pemimpin juga bermakna lain, misalnya yang disebut dalam QS. Al-Ahqaf Imam bermakna al-Qur’an. Kata imam juga memiliki arti pemimpin pasukan dan pengatur kemaslahatan (QS. Al-Baqarah: 24). Imam dalam pengertian di sini bukan pemimpin pengganti Nabi SAW.

Dalam hadis Nabi SAW, dapat ditemukan istilah-istilah imamah, khilafah, dan imarah yang semuanya bermakna pemimpin. Baik pemimpin shalat, atau pemimpin kenegaraan. seperti hadis Nabi SAW yang menyuruh Abu Bakar r.a mempimpin shalat ketika Nabi SAW sedang sakit. “Dari Abdullah ia berkata: Ketika Rasulullah SAW wafat, maka kaum Anshar berkata: “Sebaiknya dari kami dipilih seorang pemimpin dan dari kalian seorang pemimpin.” Umar ra bertanya;” Apakah kalian tidak tahu bahwa Rasulullah SAW memilih Abu Bakar untuk menjadi imam dalam shalat?” Karena itu jika salah satu dari kalian yang lebih afdhal dari Abu Bakar, maka belakangilah (tinggalkan) Abu Bakar. Mereka menjawab: “Kami berlindung dari Allah untuk membelakangi Abu Bakar”.

Bagi Syi’ah Imamiyah, memahami hadis-hadis doktrin imamah bukan saja harus bersumber dari Rasulullah SAW, namun juga dari para imam dua belas sebagai manusia-manusia suci (ma’shum). Kemutlakan imam sebagai pemimpin yang bebas dari dosa berimplikasi kepada konsep hadis. Ucapan-ucapan para imam disebut hadis. Seperti yang ditulis dalam al-Kafi Jilid I halaman 52 hadis no. 14:“Abu Abdillah as (Imam Ja’far al-Shadiq) berkata, bahwa hadisku adalah hadis ayahku (imam Muhammad al-Baqir), hadis ayahku adalah hadis kakekku (Imam Ali Zainal Abidin), hadis kakekku adalah hadis al-Husein (imam ke-3), hadis al-Husein adalah hadis al-Hasan (imam ke-2) dan hadis al-Hasan adalah Hadis Amir al-Mu’minin (Imam pertama), dan hadis Amir al-Mu’minin adalah hadis Rasulullah SAW sedang hadis Rasulullah SAW adalah firman Allah SWT”.

Kategorisasi dan parameter pengukuran hadis disebut shahih atau tidak juga berbeda dengan hadis dalam konsep Ahlus Sunnah wal Jama’ah. Menurut Syi’ah, hadis disebut shahih dengan syarat; Pertama, karena hadis itu diriwayatkan dari sumber yang dipercaya. Kedua, karena hadis itu sejalan dengan dalil lain yang bersifat pasti (qat’i) dan sejalan pula dengan konteks yang dipercaya. Dari pemahaman seperti ini (hadis Nabi identik dengan hadis para Imam), maka doktrin imamah dalam Syi’ah Itsna ‘Asyariyah adalah satu keniscayaan. Dimananpun Syi’ah dua belas berada, pasti mengamalkan doktrin esensial ini.

Saya pernah mengonfirmasi doktrin ini ke sejumlah orang-orang dan lembaga pendidikan Syi’ah di Jawa Timur. Mereka jujur meyakini bahwa perkataan Imam itu disebut hadis, dan katanya tidak mungkin salah. Perkataan imam menjadi hukum yang pasti.

Dalam pandangan mereka, imamah itu penerus nubuwwah yang ditunjuk berdasarkan nash Ilahi, karena ucapan-ucapan para Imam itu adalah identik dengan hadis Nabi yang bersumber dari wahyu Allah SWT.

Pengikut Syi’ah memang ada yang terang-terangan ada pula yang mengajarkan secara tertutup untuk kalangan mereka sendiri. Ragam respon penganut Syi’ah itu juga dipengaruhi oleh tingkat pemahaman mereka terhadap doktrin kemutlakan imamah.

Model penghayatan terhadap akidah imamah yang bertingkat-tingkat itu melahirkan model perilaku pengikut Syi’ah yang berbeda pula. Selain itu pola adaptasi Syi’ah di tengah mayoritas Sunni juga mempengaruhi perilaku pengikut Syi’ah Imamiyah. Umumnya, Syi’ah enggan berterus terang kepada kelompok lain, kecuali kepada sesama ikhwan Syi’ah.

Seperti dalam kesimpulan Prof. Dr. Mohammad Baharun dalam penelitian Syi’ah di Jawa Timur, bahwa lahirnya tipe-tipe Syi’ah itu tergantung seberapa banyak mereka menyerap doktrin imamah yang diajarkan. Ada tiga tipe yang ditemukan Prof. Baharun:

1. Syi’ah ideologis. Jama’ah Syi’ah imamah ini dididik secara sistematis, intens, serius melalui program kaderisasi. Ada yang dikader melalui pesantren ada pula di lembaga pendidikan formal. Materi-materinya meliputi mantiq, filsafat dan akidah-akidah penopang seperti konsep imamah. Kader ini ini biasanya menjadi pengikut yang militant yang tidak saja memahami teologi namun sekaligus ideology yang bersumber dari imamah. Banyak dari kader tipe ini yang disekolahkan ke pusat Syi’ah di kota Qom Iran.

2. Syi’ah “Su-Si”. Jama’ah Syi’ah model ini diperkenalkan melalui pengajian dan selebaran. Sasarannya biasanya para santri di pondok pesantren. Ada pula yang semula bersimpatik kepada Syi’ah. Model pendekatannya tidak terlalu intensif bahkan kadang setengah-setengah. Rata-rata mereka tidak memahami referensi-referensi penting Syi’ah.

Pemahamannya setengah-setengah. Saya pernah menjumpai tipe ini di sebuah daerah di Pasuruan. Orang tersebut mengaku Sunni, akan tetapi ia juga mengikuti ritual-ritual yang diadakan oleh Syi’ah, seperti karbala, menghormati para dua belas Imam, dan mengkultuskan Khomeini. Ketika shalat orang itu mengikuti cara ala Sunni. “Syi’ah sama saja, yang berbeda kulitnya. Maka saya ambil yang sekiranya baik dari Syi’ah dan Sunni”, begitu alasan tipe Su-Si. Namun tetap orang tersebut mengimani dua belas Imam sebagai pemimpin pengganti Nabi SAW. Ada pula tipe ini adalah calon kader militan. Seperti sebuah tahapan untuk meningkat ke jenjang berikutnya.

3. Syi’ah Simpatisan. Biasanya mereka pemuda yang gemar pemikiran filsafat Syi’ah. Jama’ah ini mengenal Syiah imamah melalui buku-buku, seminar yang diadakan di kampus-kampus dan pendekatan individual. Mereka juga mengagumi Revolusi Iran yang dipelopori Khomeini tahun 1979. Mereka memahami pemikiran aja. Mereka juga disebut Syi’ah pemikiran. Mereka bersifat lebih adaptif dengan Sunni tapi mereka elaboratif dalam memahami Syi’ah dua belas.

Syi’ah imamiyah di Indonesia khususnya di Jawa Timur pada dasarnya memiliki rujukan-rujukan yang sama. Yang berbeda itu tingkat memahami rujukan-rujukan tersebut. Boleh jadi Syi’ah Simpatisan atau Syi’ah ‘Su-Si’ meningkat menjadi Syi’ah Ideologis, setelah mereka memahami dan memasuki kader intensif.

Syi’ah Ideologis yang militant pun bisa sangat adaptif, meski keyakinannya termasuk fundamental. Alasannya mereka itu untuk berdakwah lebih dekat dengan Sunni, sebagai sebuah strategi merekrut anggota.

Pola adaptif di tengah mayoritas Sunni di Indonesia dipraktikkan sejak awal dari strategi seoranttokoh senior Syi’ah di kota Bangil Pasuruan. Majalah AULA – majalah milik Nahdlatul Ulama– pada edisi November 1993 pernah menurunkan berita tentang strategi Syi’ah berdakwah di Indonesia. AULA mengutip sebuah surat rahasia dari seorang di Iran. Berikut sebagaian isi surat tersebut:

“Saya ucapkan terima kasih kepada tuan atas usulan yang benar terhadap saya dan sudah lama menjadi pemikiran saya. Yaitu sejak kemenangan Imam atas Syi’ah. Walaupun saya tangguhkan hal itu, namun saya tidak ragu sedikitpun tentang kebenaran Ahlul Bait dan bukan karena takut kepada orang-orang atau jika saya tinggalkan taqiyah maka bukan supaya dipuji orang-orang. Sama sekali tidak! Akan tetapi saya sekarang mempertimbangkan situasi disekitar saya. Fanatisme Sunni secara umum masih kuat. Untuk mendekatkan mereka (kaum Sunni), saya ingin nampak dengan membuka kedok, kemudian membela serangan ulama mereka yang Nawasib (anti Syi’ah) mereka akan mengatakan: Syi’i membela Syi’ah. Saya telah berhasil merangkul sejumlah ulama mereka yang lumayan banyaknya, sehingga mereka memahami jutaan madzhab Ahlul Bait atas lainnya. Saya anggap ini sebagai kemajuan dalam langkah-langkah perjuangan kita”.

Surat ini juga sempat menjadi berita heboh di Pasuruan dan membuka pikiran sejumlah orang. Banyak yang kemudian menyadari bahwa selama ini akidah Syi’ah diajarkan secara sembunyi-sembunyi. Beberapa ulama’ kemudian tertarik untuk mempelajari kitab-kitab rujukan Syi’ah yang asli, terutama kitab al-Kafi. Dari pendekatan pustaka ini banyak yang sudah mengenal apa dan bagaimana Syi’ah di Indonesia. Memang mengkaji Syi’ah secara proprosional haruslah dengan mendekati kepada litelatur-litelatur yang diajarkan oleh Syi’ah di Indonesia. Tanpa itu, pengetahuan kita tentang Syi’ah remang-remang dan kabur.

industri pemalsu hadis produk Mu’awiyah mengakibatkan hingga saat ini umat Islam sunni berpegang teguh kepada hadis-hadis palsu yang diyakini merupakan bagian dari agama Padahal agama berlepas tangan dari semua itu

Ditipu, Sahril Lapor Polisi



Imam Hasan as. dituduh banyak nikah. Menurut sebuah riwayat, ia telahmenikah dengan tiga ratus orang wanita

.

Semua itu hanyalah fitnah yang tidak berfakta. Tuduhan itu semata-mata rekayasa yang dibuat Manshûr Ad-Dawâniqî pada saat keturunan Imam Hasan as. mengadakan perlawanan terhadapnya; gerakan yang hampir saja menggoyahkan dan meruntuhkan dinasti kerajaannya. Manshûr telah berbuat dusta atas Imam Amirul Mukminin as. dan keturunannya dengan tuduhan-tuduhan palsu

.

Seandainya semua riwayat buatan itu benar, tentunya Imam Hasan as. mempunyai anak yang sangat banyak sesuai dengan bilangan istrinya itu. Namun kenyataannya, para ahli nasab berasumsi bahwa putra-putri Imam Hasan as. hanya berjumlah dua puluh dua orang. Hal ini sama sekali tidak sesuai dengan jumlah wanita yang mereka duga telah dinikahi Imam as

.

Selain itu, mereka juga menuduh Imam Hasan as. dengan banyaknya melakukan perceraian. Seandainya tuduhan itu benar, pasti ia telah men-cerai istrinya yang bernama Ja‘dah binti Asy‘ast. Kami telah membuk-tikan kepalsuan semua tuduhan itu dengan argumentasi yang gamblang dalam kitab kami, Hayâh Al-Imam Hasan as., jilid 2.

.
Diantara pokok perbedaan Sunni dan Syi’ah adalah persoalan kepemimpinan. Syi’ah mengklaim imamah (kepemimpinan umat) bersifat profetis, sakral dan menjadi bagian dari pokok agama (ushuluddin), sementara Sunni berangagapan sebaliknya imamah bersifat profane, secular, dan hanya merupakan bagian dari cabang agama (furu’uddin)
.
Kajian sejarah kepemimpinan Islam pasca kenabian menunjukkan bahwa terdapat korelasi kuat antara kepemimpinan Islam dan islam sebagai agama. Pilihan konsep kepemimpinan justru akan menentukan “tipe  Islam” yang dianut
.
Kontroversi Kepemimpinan Umat
.
Setelah empatpuluh tahun nabi wafat, kaum muslimin mengalami dekadensi, dan demoralisasi. Silih bergantinya kekuasaan para khalifah yang penuh kontroversi yang berakhir dengan pengukuhan Mu’awiyah bin Abu Sufyan, telah mengubah sistem kepemimpinan dari khalifah menjadi kerajaan.
.
Adalah sebuah gagasan penting untuk memahami mengapa terjadi suatu penindasan atas nama agama oleh dinasti Muawiyah.
.
Dalam Islam prinsip-prinsip pengelolaan kekuasaan politik diatur secara jelas, sebab kekuasaan poitik berhubungan dengan maslahat dan mudharat bagi umat Islam. Islam bukanlah agama individual yang berhenti pada aspek internalisasi ritual vertikal, atau dengan kata lain berhenti ketika seorang muslim telah melaksanakan ibadah ritual, yang mestinya setiap ritual dalam Islam memiliki dua aspek ; individual dan sosial sekaligus.
.
Diantara doktrin prinsip pengelolaan kekuasaan tersebut dapat ditemukan dalam beberapa ayat Qu’ran ;
1. Prinsip musyawarah dan problem solving (QS : 3 ; 159)
Maka disebabkan rahmat dari Allah-lah kamu Berlaku lemah lembut terhadap mereka. Sekiranya kamu bersikap keras lagi berhati kasar, tentulah mereka menjauhkan diri dari sekelilingmu. karena itu ma’afkanlah mereka, mohonkanlah ampun bagi mereka, dan bermusyawaratlah dengan mereka dalam urusan itu kemudian . Apabila kamu telah membulatkan tekad, Maka bertawakkallah kepada Allah. Sesungguhnya Allah menyukai orang-orang yang bertawakkal kepada-Nya
.
2. Prinsip Kedilan dan Emansipasi Hukum (Equality before the Law) (QS: 5;48)
Dan Kami telah turunkan kepadamu Al Quran dengan membawa kebenaran, membenarkan apa yang sebelumnya, Yaitu Kitab-Kitab (yang diturunkan sebelumnya) dan batu ujian terhadap KitabKitab yang lain itu; Maka putuskanlah perkara mereka menurut apa yang Allah turunkan dan janganlah kamu mengikuti hawa nafsu mereka dengan meninggalkan kebenaran yang telah datang kepadamu. untuk tiap-tiap umat diantara kamu, Kami berikan aturan dan jalan yang terang. Sekiranya Allah menghendaki, niscaya kamu dijadikan-Nya satu umat (saja), tetapi Allah hendak menguji kamu terhadap pemberian-Nya kepadamu, Maka berlombalombalah berbuat kebajikan. hanya kepada Allah-lah kembali kamu semuanya, lalu diberitahukan-Nya kepadamu apa yang telah kamu perselisihkan itu, (QS: 4;58)Sesungguhnya Allah menyuruh kamu menyampaikan amanat kepada yang berhak menerimanya, dan (menyuruh kamu) apabila menetapkan hukum di antara manusia supaya kamu menetapkan dengan adil. Sesungguhnya Allah memberi pengajaran yang sebaikbaiknya kepadamu. Sesungguhnya Allah adalah Maha mendengar lagi Maha melihat
.
 3. Prinsip Distribusi Ekonomi (QS: 59;7)
Apa saja harta rampasan (fai-i) yang diberikan Allah kepada RasulNya (dari harta benda) yang berasal dari penduduk kota-kota Maka adalah untuk Allah, untuk rasul, kaum kerabat, anakanak yatim, orang-orang miskin dan orang-orang yang dalam perjalanan, supaya harta itu jangan beredar di antara orang-orang Kaya saja di antara kamu. apa yang diberikan Rasul kepadamu, Maka terimalah. dan apa yang dilarangnya bagimu, Maka tinggalkanlah.  dan bertakwalah kepada Allah. Sesungguhnya Allah Amat keras hukumannya
.
4. Prinsip Partisipasi dalam kebijakan publik (QS: 3;104)
Dan hendaklah ada di antara kamu segolongan umat yang menyeru kepada kebajikan, menyuruh kepada yang ma’ruf dan mencegah dari yang munkar; merekalah orang-orang yang beruntung.Dinasti Muawiyah telah mendiskualifikasi seluruh prinsip pengelolaan kekuasaan diatas, karena memang tidak memiliki kepentingan untuk menjalankan prinsip-prinsip tersebut
.
Satu satunya prinsip yang diaplikasikan adalah meraih kekuasaan seluas-luasnya agar dapat dimanfaatkan sebesar-besarnya untuk keuntungan sendiri dan kaum ningrat kerabatnya.Untuk mencapai tujuan politiknya, dinasti muawiyah ini menjalankan beberapa program dan agenda politiknya sebagai berikut:
.
1. Intimidasi
Aksi teror terhadap umat Islam dijalankan terhadap mereka yang tidak memberikan konsensus atas otoritas politis Muawiyah. Teror dilakukan secara terorganisir melalui jaringan aparatur pemerintahan dan pejabat-pejabat gubernur di beberapa wilayah kekuasaannya. Teror ini  dilakukan dengan cara intimidasi, pemenjaraan, pembunuhan hingga peperangan.
.
Sementara pembunuhan tanpa alasan yang sah, dalam Islam memang merupakan kejahatan fatal, sebagaimana dalam ayat QS: 5;32 oleh karena itu Kami tetapkan (suatu hukum) bagi Bani Israil, bahwa: Barangsiapa yang membunuh seorang manusia, bukan karena orang itu (membunuh) orang lain atau bukan karena membuat kerusakan dimuka bumi, Maka seakan-akan Dia telah membunuh manusia seluruhnya dan Barangsiapa yang memelihara kehidupan .seorang manusia, Maka seolah-olah Dia telah memelihara kehidupan manusia semuanya. dan Sesungguhnya telah datang kepada mereka Rasul-rasul Kami dengan (membawa) keterangan-keterangan yang jelas, kemudian banyak diantara mereka sesudah itu  sungguh sungguh melampaui batas dalam berbuat kerusakan dimuka bumi.
.
Seperti kebanyakan penguasa otoriter, maka dinasti muawiyah pun membutuhkan pemerintahan yang kuat. Untuk tujuan ini maka umat Islam dipaksa untuk mendukung, menyokong dan jika perlu memuja otoritas muawiyah. Disisi lain, terhadap rakyat dipaksa untuk membantu menyingkirkan, mendiskreditkan dan menjatuhkan siapapun yang mengganggu otoritas muawiyah. Dalam sejarah disebutkan bahwa telah terjadi propaganda anti Imam Ali as. Dengan melakukan penghujatan dalam tiap akhir mimbar jum’at di masjid-masjid dalam wilayah kekuasaan mu’awiyah.
.
Salah satu skandal pembunuhan tokoh penting – terhadap sahabat nabi yang sangat dihormati – adalah pembunuhan terhadap Hujr ibn Adi dan para pengikutnya. Latar belakang pembunuhan tersebut adalah suatu upaya untuk menyingkirkan pengaruh Imam Ali as. Dan pengikutnya (syi’ah Ali), agar “stabilitas” pemerintahan dapat terkendali. Metode represif dalam pengendalian stabilitas tersebut adalah untuk menciptakan ketakutan-ketakutan dan membungkam kelompok-kelompok oposisi.
.
Sejarahwan telah merekam kisah-kisah yang dialami korban penindasan Muawiyah, diantaranya adalah yang terjadi pada ‘Amr bin Al-Hamaq Al-Khuzâ‘î. Allah memandang bahwa membunuh seseorang itu adalah sebagai membunuh manusia seluruhnya, karena orang seorang itu adalah anggota masyarakat dan karena membunuh seseorang berarti juga membunuh keturunannya
.
‘Amr bin Al-Hamaq Al-Khuzâ‘î Seorang pecinta dan pendukung Ahlul Bait Rasul. Dalam pelariannya ke kota moshil ‘Amr bin Al-Hamaq Al-Khuzâ‘î tertangkap kemudian dibawa dan dihadapkan kepada gubernur moshil Abdurrahman bin Abdullah bin Utsman Ats-tsaqofi. Setelah mendapat arahan dari Mu’awiyah, sang gubernur diperintahkan untuk mencambuk sebanyak lima kali. ‘Amr bin Al-Hamaq Al-Khuzâ‘î yang pada saat itu sakit, hanya dengan sekali cambuk langsung menemui ajalnya. Namun yang mengejutkan adalah setelah kematiannya kepala Amr dimutilasi. Kemudian kepala tersebut dibawa, dipertontonkan di pasar dari satu kota ke kota lain hingga berakhir di Damaskus. Inilah kepala pertama yang dikirim sebelum kepala Imam Husein as. Dan kepala para syuhada karbala.
.
2. propaganda
Disamping terror dan intimidasi, cara yang juga efektif untuk menyingkirkan lawan politiknya adalah dengan melakukan propaganda atau kampanye hitam demi untuk mempengaruhi opini publik. Dinasti Muawiyah menggunaakan pengaruh agitasi untuk mendiskreditkan Imam Ali as. secara massif selama dua abad.
.
Jika kita merujuk pada peradaban lain, terdapat hal yang sama. Di India kuno, menjelang tahun 400 SM di India, Kautilya seorang Brahmana yang diduga menteri besar dalam Kekaisaran Candragupta Maurya menulis Arthashastra (Prinsip-prinsip Politik), sebuah buku nasihat bagi para penguasa yang sering dibandingkan dengan Republic karya Plato dan The Prince karya Machiavelli
.
Kautilya membahas penggunaan perang psikologis (psywar) baik yang tebuka maupun rahasia dalam upaya mengganggu militer musuh dan merebut ibu kota. Ia menulis bahwa para propagandis raja harus menyatakan bahwa ia bisa mempraktekan sihir, para “Dewa” dan orang-orang bijak (intelektual) berada dipihaknya  dan bahwa semua orang mendukung tujuan perangnya yang akan meraih manfaat. Dalam cara-cara rahasia, agen-agen propagandis harus menyusup ke kubu musuh untuk menyebarkan berita yang salah ditengah rakyat di ibu kota, diantara kalangan pemimpin dan militer
.
Nasihat yang sama juga dilontarkan oleh Sun Tzu dalam karyanya Ping-fa (The Art of War) yang menulis pada periode sama. Bahwa “Semua perang berdasarkan pengelabuan. Oleh karena itu, ketika mampu menyerang, kita harus terlihat tidak berdaya, ketika kita menggunakan kekuatan, kita harus terlihat tidak aktif, ketika kita dekat, kita harus membuat percaya bahwa kita sangat jauh, ketika kita berada jauh, kita harus membuat mereka yakin kita dekat. Tahan musuh, munculkan kekakaucan dan serang mereka”
.
Rekayasa dan pemalsuan hadits untuk mendiskreditkan tokohtokoh Ahlul Bait dilakukan secara sistematis dengan tujuan untuk mendistorsi, merusak dan menjungkirbalikkan ajaran Islam yang dibawa olah nabi saww. Kemudian Bani umayah ingin mengganti Islam yang murni ini dengan Islam yang kompatibel / cocok dengan sistem kekuasaan Muawiyah
.
Ibn Abil Hadid al Mu’tazili menulis bahwa Muawiyah mendorong pengikutnya dan pendukungnya untuk meriwayatkan beberapa hadits yang memojokkan Imam Ali, diantaranya Abu hurairoh, Amr bin Ash, Mughirah bin Syu’bah dan Urwah bin Zubair
.
3 Kesenjangan ekonomi
Demi tercapainya kekuatan pemerintahan muawiyah, maka sumber ekonomi umat harus dikuasai dan dimonopoli. Dalam konteks pemerintahan muawiyah distribusi kesejahteraan masyarakat disesuaikan dengan tingkat loyalitas masyarakat terhadap otoritas muawiyah. Makin setia, maka akan makin sejahtera Dengan kebijakan ini maka prinsip-prinsip keadilan ekonomi yang tertuang dalam QS; 59:7 telah dicampakkan. Hasilnya tentu saja kesenjangan ekonomi yang semakin  melebar
.
Sejarahwan muslim telah mencatat keadaan ekonomi pada masa awal dinasti Muawiyah, telah terjadi kesenjangan ekonomi yang dalam antara golonagan kaya (kaum aristocrat) dan kaum miskin (umat Islam). Kendatipun kondisi ini telah tercipta pada masa khalifah Utsman ibn Affan dengan kebijakan ekonominya yakni “ekonomi kekeluargaan”. Maka pengangkatan pejabat politik wilayah yang berbau nepotisme telah menjadi pintu masuk dari kondisi struktur ekonomi yang timpang
.
Posisi Imam Ali as. Sebagai khalifah penggantinya yang banyak mereformasi struktur pemerintahan, pengelolaan administrasi baitul maal ternyata hanya merupakan selingan dari transformasi Utsman bin Affan kepada Mu’awiyah bin Abu Sufyan
.
Muawiyah menempatkan Amr ibn Ash sebagai gubernur Mesir, dan para sejarahwan mencatat harta kas Amr senilai 325.000 Dinar dan 1.000 dirham60, lahan pertanian senilai 200.00 dinar, Istana di al-What Mesir senilai 10.000 dinar. Marwan bin Hakam mendapat 500.000 Dinar yang bersumber dari pengumpulan pajak di wilayah Afrika juga memiliki rumah-rumah mewah. Sa’ad bin Abi Waqash meninggalkan warisan harta sejumlah 250.000 dirham, demikian pula dengan Zaid bin Tsabit telah mweninggalkan rumah-rumah mewah senilai 100.000 dinar. Disisi lain kerawanan pangan, kelaparan, dan kemiskinan melanda umat Islam. Pemerintahan Muawiyah tidak saja mengabaikan kondisi ini, namun juga tanpa belas kasih memelihara diskriminasi ekonomi untuk tujuan kelanggengan kekuasaannya
.
Sebagaimana telah ketahui luas bahwa pemerintahan nepotism Bani Umawiyah ini telah dimulai sejak masa Utsman bin Affan. Rezim inilah yang telah dengan sengaja by design membagi kelas social masyarakat Islam menjadi dua strata ; kelas bangsawan dan kelas rakyat jelata
.
Seorang sahabat nabi bernama Abi Dzar al Ghifari mengomentari kondisi yang terjadi dimasa Utsman bin Affan ; “ Saya heran mengapa orang yang tak punya makanan dirumah tidak menghunuskan pedang dan menyerang orang-orang itu. Ketika kemiskinan datang ke suatu kota, maka kekafiran akan meminta untuk mengambilnya sendiri.”
.

wajah politik Mu‘âwiyah yang dengan terang-terangan menentang Al-Qur’an dan Sunah Rasulullah saw. Ia membunuh orang-orang yang tidak berdosa dan orang-orang saleh seperti: Hujr bin ‘Adî, ‘Amr bin Al-Hamaq Al-Khuzâ‘î, dan para sahabat yang lain secara zalim. Dia juga merusak kehormatan kaum muslimin, menawan kaum wanita, merampas harta benda, dan mengangkat orang-orang bejad sebagai aparat peme-rintahannya seperti: Ibn ‘Ash, Ibn Syu‘bah, Ibn Arthah, Ibn Hakam, Ibn Marjânah, dan Ibn Sumayyah

.

Orang terakhir ini telah dipisahkan oleh Mu‘âwiyah dari ayahnya yang sah, yaitu ‘Ubaid Ar-Rûmî, kemudian menisbahkan kepada ayahnya sendiri yang durjana, Abu Sufyân. Dia telah memberikan kekuasaan untuk memerintah penduduk Syi‘ah Irak kepada anak durjana ini. Dengan kekuasaannya itu, Ibn Sumayyah telah membebankan berbagai kesengsaraan kepada rakyat di sana, menyem-belih anak-anak mereka, mempermalukan kaum wanita mereka, memba-kar rumah-rumah mereka, dan merampas harta benda mereka ..

.

Salah satu kejahatan dan kezaliman Mu‘âwiyah yang terbesar ialah usahanya membunuh cucu Rasulullah saw., Imam Hasan as. Dia telah menyusupkan racun untuk Imam Hasan as. melalui tangan istrinya yang bernama Ja‘dah bin Asy‘ats. Dia merayu Ja‘dah dan berjanji akan menikahkannya dengan Yazîd. Ja‘dah terkutuk itu membubuhkan racun sementara Imam Hasan as. sedang berpuasa. Racun itu merobek-robek usus Imam Hasan as. dengan cepat. Tidak lama setelah itu, rohnya yang suci segera kembali ke haribaan Tuhannya dengan membawa berbagai musibah, duka, dan kesedihan yang ditimpakan oleh Mu‘âwiyah. Innâ lillâhi wa innâ ilaihi râji‘ûn!

.

Mu‘âwiyah melengkapi kejahatan dengan mengangkat anaknya sen-diri, Yazîd, sebagai khalifah Muslimin. Anak ini telah merusak dan meng-hancurkan Islam dan umatnya. Tak ada kejahatan yang disisakannya. Di antara kejahatannya yang terbejat adalah tragedi Thuff di Mekah dan tragedi Harrah, serta berbagai petaka lainnya yang telah mengubah kehidupan Muslimin menjadi neraka Jahanam yang sulit dibayangkan.[]

.
Legitimasi Agama 
Muawiyah menyadari bahwa seluruh agenda politik seperti intimidasi, propaganda, monopoli ekonomi, dalam rangka penguatan kekuasaannya, tidak akan dapat dijalankan tanpa ada legitimasi agama. Mengingat masa kekuasaannya adalah masa yang tidak terlalu jauh dengan masa kenabian, dan banyak diantara para sahabat nabi masih hidup. Maka untuk menghindari kritik atas pelaksanaan pemerintahan yang diarahkan pada dirinya, Muawiyah mencoba untuk membungkam kelompok kritis yang berseberangan dengannya, dengan cara penyuapan atau jika tak dapat disuap diintimidasi
.
Muawiyah menghimpun intelektual bayaran yang terdiri dari kelompok penyair, tukang cerita, dan ulama bayaran. Tugas mereka tak lain adalah menjaga “stabilitas” pemerintahan dengan cara memberikan legitimasi keagamaan atas kebijakan publiknya.Pada masa inilah kemudian muncul dan berkembang paham teologi yang di rekayasa oleh para elite intelektual gadungan atas sponsor Muawiayah. Bahkan paham ini telah sangat jauh melenceng dari spirit ajaran Islam paling fundamental, Diantara sebagian paham-paham itu adalah ;
.
a. Paham fatalis (jabariyah)
Paham ini percaya bahwa semua peristiwa terjadi memang sudah ditetapkan kejadiannya jauh sebelum penciptaan alam semesta, sehingga manusia tak sanggup untuk mengubah nasibnya sendiri. Muawiyah adalah orang yang menghidupkan keyakinan ini. Qadhi Abdul Jabbar mengutip perkataan Muawiyah “Perkara Yazid ini merupakan takdir Allah dalam perkara ini kita tidak memiliki kehendak atau pilihan. ”Pada satu kesempatan Ubaidullah bin Ziyad bertanya pada Imam Sajjad ; “Bukankah Allah yang membunuh Ali Akbar?” “Orang (manusia) yang membunuh kakaku” Jawab Imam Sajjad. Paham ini, disatu sisi bertujuan untuk mengokohkan legitimasi pemerintahan Muawiyah, disisi lain betujuan untuk membelokkan umat Islam dari aqidah jihad dan amar ma’ruf nahi mungkar dengan pola pengingkaran umat Islam terhadap taklif (tanggung jawab keagamaan)
.
b. Paham Jama’ah
Suatu ketika Ibn Ishak melihat Syimr ibn dzil-Jaushan (pembunuh Imam Husein) shalat di masjidil haram dan berdoa ; “Ya Allah Engkau sungguh tahu bahwa aku ini bermartabat, karena itu ampunilah aku” Ibn Ishak menyela ; “mana mungkin diampuni, kalau ternyata kamulah orangnya yang membantu pembunuhan putra Nabi !” “Apa yang telah kami lakukan?” tukas Syimr. “Itu adalah perintah komandan kami, kami tak dapat menolak,  jika tidak dilaksanakan maka kami lebih rendah kedudukannya disbanding binatang buas!” Ibnu Ziyad ketika melakukan briefing kepada tentaranya sebelum peristiwaw pembantaian di Karbala, menegaskan ; “Jangan sampai lupa ketaatan dan persatuan, jangan sekalisekali ragu untuk membunuh orang yang memisahkan diri dari agama dan terlibat konflik dengan ‘Imam’ (Muawiyah).”  Pada awalnya istilah bay’ah (perjanjian) merupakan konsensus dan pengakuan sukarela atas pengemban otoritas politis terhadap umat Islam yang didasarkan pada kapasitas, kualifikasi kepemimpinan  dan tuntunan ilahiyah. Namun konsepsi ini diselewengkan pihak Muawiyah dari sebuah ‘konsensus’ menjadi sebuah ‘paksaan’, dari kepemimpinan berkapasitas profetis menjadi kepemimpinan berkapasitas bandit
.
Pergeseran esensi konsep kepemimpinan ini telah terjadi sejak kontroversi penetapan Khalifah pertama, dan berpuncak pada syahadah Imam Husein as. Dinamika awal kepemimpinan Islam pasca kenabian menunjukkan korelasi kuat antara kepemimpinan Islam dan islam sebagai agama. Pilihan konsep kepemimpinan justru akan menentukan “tipologi  Islam” yang dianut
.
Dalam AlQur’an, Allah berfirman (QS; 4:59) ;  Hai orang-orang yang beriman, taatilah Allah dan taatilah Rasul (Nya), dan ulil amri di antara kamu. kemudian jika kamu berlainan Pendapat tentang sesuatu, Maka kembalikanlah ia kepada Allah (Al Quran) dan Rasul (sunnahnya), jika kamu benar-benar beriman kepada Allah dan hari kemudian. yang demikian itu lebih utama (bagimu) dan lebih baik akibatnya.
.
Ayat di atas berkaitan dengan salah satu isu Islam yang paling penting, yaitu masalah kepemimpinan ilahiyah. Jadi pada prinsipnya, kepemimpinan adalah kunci rahasia bagi kemajuan dan kemunduran kemanusiaan. Seorang pemimpin yang lemah dan tidak berkompeten akan menyesatkan rakyat dan membawanya kepada kehancuran, sedangkan pemimpin yang kuat dan berkompeten akan memimpin rakyat menuju kesejahteraan material dan spiritual. Sebuah kepemimpinan yang benar akan membuka jalan bagi yang berpotensi untuk berkembang, sedangkan kepemimpinan palsu akan menghancurkan potensi umat.
.
Intisari ajaran yang tertuang pada ayat diatas terdiri dari tiga tahap : tahap pertama, memerintahkan orang beriman untuk taat kepada Allah, karena Dia adalah sumber dari semua jenis ketaatan, maka kepemimpinan harus datang dari yang Maha Perkasa. Pada tahap kedua ia memerintahkan orang percaya untuk mengikuti dan menaati Rasul-Nya, Nabi saww. yang sempurna dan tidak bertindak sesuai dengan keinginan pribadinya.
.
Pada tahap ketiga dan terakhir Ia memerintahkan orang beriman untuk mematuhi otoritas kepemimpinan Ulul amri, Mereka adalah yang berasal dari kalangan masyarakat muslim yang menjaga Islam dari aspek material dan spiritual dari kehidupan seorang muslim. Namun siapakah mereka yang dapat disebut sebagai pemangku otoritas Ulil Amri?
.
Konsep Kepemimpinan dan Islam
.
Mayoritas ulama Sunni dan para penafsir Quran memandang Ulul-Amri adalah penguasa dan negarawan pada setiap zaman.  Akibatnya, setiap muslim berkewajiban untuk mematuhi mereka sebagai-pemerintah, apapun esensi pemerintahan mereka adil atau zhalim
.
Meskipun ini pendapat tradisional yang umum dari para ulama Sunni, namun ada beberapa pemikir kontemporer dan intelektual  Sunni yang telah menolak pendekatan tradisional dan menegaskan bahwa “kita berkewajiban untuk mematuhi mereka dengan syarat  bahwa mereka tidak melanggar aturan Islam dan hukum”. Sayid Quthb dalam tafsirnya, Fi zhilalil Qur’an. Ini adalah contoh pendekatan baru dalam menerjemahkan konsep kepemimpinan
.
Legitimasi pendekatan tradisional atas Ayat Ulul Amri (misal QS; 4:59) dalam kutipan sebelumnya adalah memerintahkan kita untuk benar-benar taat kepada Allah, Rasul-Nya, dan Ulul-Amr tanpa syarat mempertanyakan kualifikasi Ulul Amri yang dimaksud. Alasannya adalah, bahwa ketidaktaatan kepada “pihak berwenang” di atas dapat mengganggu stabilitas dan ketenangan umat. Konsep serupa dapat kita bandingkan dengan pasal-pasal dari UndangUndang Subversi warisan kolonialis
.
Justifikasi lain yang merupakan salah satu sebab utama adalah bahwa banyak Hadis yang diklaim sebagai dikutip dari Nabi yang menyatakan bahwa para penguasa harus dipatuhi, terlepas dari perilaku mereka dan kualifikasinya
.
Hadis tersebut dibuat dalam skala besar diproduksi dalam pabrik hadis. Industri hadis ini didirikan pada masa pemerintahan dinasti Mu’awiyah. Tujuan dari pabrikasi tersebut, adalah pembenaran kepemimpinan palsu mereka untuk menyesatkan umat Islam
.
Berikut ini adalah beberapa contoh produk hadits Bani Umaiyah :
Diriwayatkan dari Huzhaifah bahwa Nabi telah berkata: “Akan ada penguasa setelahku, yang mereka tidak mengikuti sunahku. Di antara mereka ada yang hatinya seperti hati setan dalam tubuh manusia” Huzhaifah Kemudian bertanya pada Nabi tentang apa yang harus ia lakukan? Nabi menjawab: “Dengarkan dan ikuti penguasa anda, meskipun ia merampas harta benda dan ternak anda” (Muslim 6: 21).
.
Diriwayatkan dari Ibn-Abbas telah dikutip dari Nabi mengatakan:  “Barangsiapa melihat pemimpinnya sesuatu yang menjijikkan darinya, ia harus bersabar, karena siapa saja yang pergi satu langkah atau satu rentang dari mayoritas jama’ah maka dia akan mati dalam keadaan mati jahiliyah. “ Berdasarkan hadits-hadits diatas, seorang ulama Sunni yang bernama Abubakar Ibn Arabi telah menegaskan dalam bukunya Al-Awasim bahwa: “(Imam) Husain dibunuh oleh pedang kakeknya (maksudnya hadits-nya), karena ia memberontak terhadap Imam (Yazid)”.
.
Diriwayatkan dari Abdullah bin Umar yang dikutip dari Nabi telah berkata: “Barangsiapa mendurhakai pemerintahannya, ia akan bertemu dengan Allah di akhirat sedangkan dia tidak memiliki bukti atas apa yang telah dilakukan, dan orang yang meninggal tanpa memiliki kesetiaan dari pemerintah ia telah meninggal dan mati Jahiliyah (non-Muslim)” (Muslim 6:20) Abdullah Ibn Umar mengutip hadits tersebut setelah pembantaian yang terjadi di Harra,
Madinah tiga tahun setelah peristiwa Asyura di Karbala.
.
Imam Nawawi dalam syarahnya berkata dalam penjelasan dari hadis tersebut di atas:
“Semua ulama yang ahli hukum Sunni, perawi dan teolog telah sepakat bahwa khalifah tidak akan jatuh karena korupsi dan kesalahan dan pengabaian kepentingan publik. Jadi tidak ada yang diperbolehkan untuk bangkit melawan dia (penguasa zhalim). Paling banter hal yang diizinkan adalah memberi beberapa nasihat dan menakut-nakuti dia dari azab Allah, karena Hadis mengatakan kepada kita untuk melakukannya.
.
Sepanjang sejarah Islam, ulama Sunni telah telah berperan dalam melakukan pengelabuan terhadap kaum muslimin, disebabkan oleh ketergantungan mereka pada industri pemalsuan hadits produk Mu’awiyah. Mereka berdoa di belakang siapa pun yang memimpin  doa, mereka berbay’at kepada siapa pun penguasa mereka. Kemudian disisi lain kaum Syi’ah dituduh menjadi pemberontak dan teroris.
.
Banyak kejahatan dalam sejarah Islam yang dibenarkan oleh doktrin palsu tersebut. Masa  Yazid dalam peristiwa Harra di kota suci Nabi saaw., pembantaian ratusan umat Islam Madinah yang tidak bersalah menjadi saksi sejarah. Kota suci Nabi saww. Telah dilanggar kesuciannya, dimana telah terbunuh 700 diantaranya adalah mereka yang hafal Quran, 1000 anak perempuan diperkosa dan harta mereka dirampas selama tiga hari oleh tentara Yazid,semua di bawah legitimasi mematuhi khalifah.
.

.

Mu‘âwiyah telah menetapkan beberapa jurus politiknya berikut ini:

  1. Melakukan teror terhadap tokoh-tokoh Islam seperti Hujr bin ‘Adî, Maitsam At-Tammâr, Rasyîd Al-Hijrî, ‘Amr bin Al-Hamaq Al-Khuzâ‘î dan tokoh-tokoh besar lainnya. Para tokoh Islam ini telah dibantai, karena mereka adalah manifestasi kekuatan yang menen-tang kekuasaannya dan menghalang-halangi alur politiknya yang telah ia lempangkan atas dasar kezaliman dan diktatoris.
  2. Menghapus kemuliaan Ahlul Bait yang merupakan poros kesadaran sosial dalam Islam dan urat nadi yang penting di dalam tubuh umat yang senantiasa membantu mereka untuk bangkit dan melakukan perlawanan. Oleh karena itu, Mu‘âwiyah mewajibkan umat Islam untuk mencerca mereka dan menjadikan kebencian kepada mereka sebagai bagian dari kehidupan Islam. Dalam hal ini, Mu‘âwiyah telah menggunakan sarana pendidikan dan pengajaran, juga sarana ceramah dan bimbingan demi menghapus kemuliaan Ahlul Bait as. Bahkan Mu‘âwiyah mewajibkan masyarakat Islam untuk mengutuk Ahlul Bait di atas mimbar-mimbar pada salat Jumat, salat hari raya Idul Fitri, Idul Adha, dan pada kesempatan-kesempatan lainnya.
  3. Mengadakan perubahan atas realita Islam dan seluruh ajaran dan pondasinya. Mu‘âwiyah telah membentuk lembaga untuk membuat hadis-hadis palsu atas nama Rasulullah saw. Para pembuat hadis-hadis palsu itu telah berbuat dusta yang bertentangan dengan akal dan jalur kehidupan. Dan sangat disayangkan bahwa hadis-hadis palsu tersebut tercantum pula di dalam sebagian kitab-kitab sahih dan lainnya sehingga para ulama yang memiliki kepedulian terhadap ajaran Islam terpaksa menulis kitab yang menjelaskan hadis-hadis palsu tersebut. Menurut anggapan saya, kejahatan ini merupakan tragedi yang paling besar bagi umat Islam. Karena hingga saat ini, sebagian umat Islam masih banyak yang berpegang teguh kepada hadis-hadis palsu tersebut dan mereka meyakini bahwa hal itu merupakan bagian dari agama mereka. Padahal agama berlepas tangan dari semua itu.

Peringatan Imam Husain as. kepada Mu‘âwiyah

Imam Husain as. memberikan peringatan keras terhadap Mu‘âwiyah. Dalam peringatan itu, ia menolak politik kotor Mu‘âwiyah yang menen-tang kitab Allah dan sunah Nabi-Nya. Ia juga menegur pembunuhan yang dilakukannya terhadap para pemuka Islam. Peringatan Imam Husain as. tersebut merupakan dokumentasi politik penting yang mene-barkan berbagai kejahatan dan kezaliman Mu‘âwiyah. Hal ini telah kami jelaskan dalam buku kami, Hayâh Al-Imam Husain as

.

Seminar Politik di Mekah

Imam Husain as. pernah mengadakan seminar politik umum tahunan di Mekah. Dalam seminar itu, ia mengundang para jamaah haji, baik dari ka-langan Muhajirin maupun Anshar, dan jamaah haji lainnya. Ia menyam-paikan ceramah mengenai berbagai bencana dan cobaan yang menimpa keluarga Rasulullah saw. pada masa pemerintahan Mu‘âwiyah sang tiran

.

Berikut ini adalah cuplikan pidato Imam Husain as. dalam seminar tersebut:

Sesungguhnya si penguasa tiran ini—yakni Mu‘âwiyah—telah memperlakukan kami dan Syi‘ah kami dengan kejahatan seba-gaimana yang kalian lihat, saksikan, dan ketahui. Kali ini, aku ingin menanyakan sesuatu kepada kalian. Jika aku benar, maka benarkanlah aku, dan jika aku berdusta, maka dustakanlah aku. Dengarkanlah ucapanku dan tulislah perkataanku, kemudian kembalilah kalian ke tempat tinggal dan kabilah kalian. Ajaklah orang-orang yang kalian percaya dan kalian anggap jujur untuk mengetahui hak-hak kami sebagaimana yang kalian ketahui. Sesungguhnya aku merasa khawatir persoalan ini akan sirna dan terkalahkan. Tetapi Allah swt. akan menyempurnakan cahaya-Nya walaupun orang-orang kafir membencinya

.

Imam as. mengakhiri seminar itu dengan menjelaskan keutamaan-keutamaan Ahlul Bait as. dan upaya Mu‘âwiyah untuk menghapuskannya. Muktamar ini adalah muktamar pertama yang pernah diadakan dalam Islam

.

Penolakan Imam Husain as. Terhadap Kekhalifahan Yazîd

Mu‘âwiyah berusaha keras untuk mengangkat anaknya, Yazîd, untuk menjadi khalifah muslimin. Ia memanfaatkan seluruh sarana negara agar kekhalifahan dan kerajaan tersebut dapat dipegang oleh keturunannya. Imam Husain as. adalah orang yang paling keras menolak dan menentang upaya tersebut. Karena Yazîd sama sekali tidak memiliki kelayakan untuk menjadi khalifah muslimin. Imam as. menjelaskan sifat-sifat Yazîd dengan ucapan: “Sesungguhnya dia (Yazîd) adalah peminum arak dan pemburu binatang. Dia senantaisa menaati setan dan meninggalkan perintah Ar-Rahmân. Dia menampakkan kerusakan, menghapus hukum-hukum Allah, menghalalkan apa yang telah diharamkan Allah, dan meng-haramkan apa yang telah dihalalkan Allah.”

Setiap kali Mu‘âwiyah berusaha meyakinkan Imam Husain as. untuk membaiat Yazîd, Mu‘âwiyah tidak pernah menemukan peluang untuk itu

.

Kematian Mu‘âwiyah

.

Ketika penguasa tiran Mu‘âwiyah telah mati, Walîd, penguasa kota Madinah, memanggil Imam Husain as. supaya berbaiat kepada Yazîd. Imam Husain as. menolak permintaan tersebut seraya berkata: “Hai Amir, sesungguhnya kami keluarga kenabian adalah sumber risalah dan tempat para malaikat datang silih berganti. Dengan perantara kami Allah membuka risalah kenabian dan dengan kami pula Dia menutup kenabian. Sesungguhnya Yazîd adalah orang fasik, peminum khamar, pembunuh orang-orang tak bersalah, dan berbuat kefasikan secara terang-terangan. Orang sepertiku ini tidak akan membaiat orang seperti dia.”

.

Imam Husain as. menolak untuk membaiat Yazîd, sebagaimana seluruh keluarga kenabian juga menolak untuk membaitnya karena mengikuti pemimpin mereka, Imam Husain as

.

.

>> Ali dengan Mu’awiyah cs
Az­Zamakhsyari dalam Rabi’al­Abrar dan Suyuthi menceritakan: ‘Di zaman Umayyah lebih dari 70.000 mimbar digunakan untuk melaknat Ali bin Abi Thalib’. Mimbar­mimbar ini menyebar di seluruh wilayah dari ufuk Timur ke ufuk Barat. Al­Hamawi berkata: Ali bin Abi Thalib dilaknat di atas mimbar­mimbar masjid dari Timur sampai ke Barat kecuali masjid jami’ di Sijistan”. Di masjid ini hanya sekali terjadi khatib melaknat Ali. Tetapi pelaknatan di mimbar Haramain, Makkah dan Madinah, berjalan terus’

.

Mughirah bin Syu’bah yang jadi gubernur di Kufah menyuruh jemaah masjid mengutuk Ali dengan kata­kata: ‘Wahai manusia, pemimpinmu menyuruh kepadaku untuk melaknat Ali, maka kamu laknatilah dia’. jemaah berteriak ‘Mudah­mudahan Allah melaknati dia!’. Tetapi dalam hati, yang mereka maksudkan dengan ‘dia’ adalah Mughirah. Pelaknatan Mughirah terhadap Imam Ali dilakukan terus menerus. Sekali ia mengatakan dalam khotbahnya: ‘Sesungguhnya Rasul Allah saw tidak menikahkan putrinya dengan Ali karena Rasul menyukai Ali, tetapi untuk memperbaiki hubungannya dengan keluarga Abu Thalib’. Pada suatu ketika ia ditegur sahabat Zaid bin Arqam: ‘Hai Mughirah, apakah engkau tidak tahu bahwa Rasul saw melarang mencerca orang yang sudah mati? Tidakkah engkau melaknat Ali dan ia sudah meninggal?

.

Amir bin Sa’ad bin Abi Waqqash yang berkata: Mu’awiyah berkata kepada Sa’d: ‘Apa yang menghalangimu melaknat Abu Turab?’. Sa’ad menjawab: ‘Ada tiga hal yang diucapkan RasulAllah saw sehingga aku tidak akan pernah mencacinya, karena bila saja aku mendapat satu dari tiga keutamaan itu aku lebih suka dari pada memiliki harta apa saja yang paling berharga. Kemudian ia menyebut hadis al-­Manzilah, ar-­Rayah (bendera) dan al-­Mubahalah

.
Dalam lafal Thabari: ‘Tatkala Mu’awiyah naik haji, ia berthawaf bersama Sa’ad dan setelah selesai, Mu’awiyah pergi ke Dar an­Nadwah dan mengajak Sa’ad duduk bersama di ranjangnya (sarir) dan Mu’awiyah mulai memaki Ali, Sa’ad bangkit dan berkata: ‘Engkau mengajak aku duduk bersama di ranjangmu kemudian engkau memaki Ali, demi Allah bila aku dapat satu saja yang didapat Ali aku lebih suka dari apa yang dapat didatangkan matahari’? sampai ia selesai mengemukakan hadis dan Sa’ad bicara: ‘Demi Allah aku tidak akan memasuki rumahmu!’

.
Meskipun Sa’d bin Abi Waqqash tidak mau membaiat Ali, tetapi ia tidak dapat berdiam diri dan menegur Mu’awiyah. Bila ada Sa’ad, satu dari enam anggota Suyura, Muawiyah tidak berani melaknat Ali. Tatkala ia akan berkhotbah di masjid Nabi dan akan melaknat Ali, Sa’ad berkata: ‘Bila engkau melaknat Ali aku pasti keluar dari masjid’. Sa’ad bin Abi Waqqash, setelah meninggalnya Utsman, hidup menyendiri. Pertemuannya dengan Mu’awiyah hampir selalu terjadi di masjid. Ia memanggil Mu’awiyah sebagai raja dan bukan khalifah. Setelah Ali meninggal, hanya ia seorang diri lagi yang anggota syura dan selalu mengatakan kesalahannya tidak membaiat Ali. ‘Saya telah mengambil keputusan yang salah. Dan tatkala orang menyalahkannya karena tidak mau mendukungnya memerangi Ali ia berkata: ‘Saya menyesal tidak memerangi al­fi’ah al­bighiah, kelompok pemberontak (yaitu Mu’awiyah)

.
Demikian pula dengan Abdullah bin Umar, meski tidak membaiat kepada Ali pada akhirnya berkata: ‘Saya tidak pernah menyesal hidup di dunia, kecuali tidak berperang bersama Ali bin Abu Thalib melawan kelompok pemberontak sebagaimana diperintahkan Allah’

.

Pada satu hari Muawiyah sedang duduk-duduk dengan teman-temannya. Ahnaf bin Qais juga hadir. sementara itu seorang Syria datang lalu berpidato. pada akhir pidatonya ia mencerca Ali. mendengar itu Ahnaf berkata kepada Muawiyah, tuan! bila orang ini mengetahui bahwa anda akan merasa senang bila para Nabi dikutuk maka ia pun akan mengutuk mereka. Takutlah kepada Allah dan janganlah mengusik-usik Ali lagi. Ia sudah menemui Tuhannya. ia sekarang sendirian di kuburnya dan hanya amalnya yang menyertainya. Saya bersumpah demi Allah bahwa pedangnya sangat suci dan pakaiannya pun sangat bersih dan rapi, tragedi yang menimpanya besar

.
Muawiyah berkata, “Hai Ahnaf! engkau telah menaburkan debu ke mata saya dan berkata sesukamu. Demi Allah, engkau harus naik ke mimbar dan melaknat Ali. bila engkau tidak melaknatnya dengan sukarela maka engkau akan dipaksa melakukannya. Ahnaf menjawab, “Sebaiknya anda memaafkan saya dari melakukannya. namun meskipun anda memaksa saya, saya tetap tidak akan mengucapkajn kata-kata semacam itu. lalu Muawiyah menyuruhnya naik ke mimbar. Ahnaf berkata, Bila saya naik ke mimbar maka saya berlaku jujur. Muawiyah berkata, Bila engkau jujur, apa yang akan kau ucapkan? Ahnaf menjawab, “setelah naik ke mimbar maka saya akan memuji Allah lalu berkata begini, “Wahai manusia! Muawiyah telah menyuruh saya untuk mengutuk Ali. Tiada ragu bahwa Ali dan Muawiyah saling bermusuhan. Masing-masing mengaku bahwa pihaknya yang telah dizalimi. Oleh karena itu bila saya berdoa, hendaklah anda sekalian mengamininya” lalu saya akan berkata, “Ya Allah! Kutuklah salah satu dari kedua orang ini yang durhaka, dan biarkanlah para malaikat, nabi-nabi serta seluruh makhluk-Mu mengutuknya. Ya Allah! Limpahkanlah kutukan-Mu kepada kelompok pendurhaka. Wahai hadirin, ucapkanlah Amin. Wahai Muawiyah, saya tidak akan mengucapkan apa-apa selain kata-kata ini, walaupun saya harus kehilangan nyawa saya. Muawiyah menjawab, “Ya, kalau bbegitu aku memaafkanmu (dia naik ke mimbar dan mengutuk)

.

Mengenai alasan pelaknatan Ali bin Abi Thalib, dapat dijelaskan dengan riwayat dari Umar Bin Abd al-Aziz berikut ini: Pada waktu itu ayahku adalah gubernur di Makkah. Aku mendengar ayahku bicara lancar sampai pada saat ia melaknat Ali dan suaranya jadi tidak jelas, terbata­bata dan menyesakkan, hanya Allah yang tahu. Dan aku terheran­heran melihat yang demikian itu. Maka suatu hari aku bertanya kepadanya: ‘Wahai ayah, engkau berkhotbah begitu fasih dan lancar, belum pernah aku lihat engkau berkhotbah begitu baik, tetapi setelah engkau sampai pada melaknat lelaki itu engkau lalu tergagap-­gagap tidak karuan. ‘Ayahku menjawab: ‘Wahai anakku, andaikata orang Syam atau siapa saja yang berada di bawah mimbar mengetahui keutamaan lelaki ini seperti yang diketahui ayahmu ini, maka tiada seorang pun akan mengikuti kita”

.

>>Amr bin Hamaq vs Mua’wiyah
Orang pertama yang dipenggal kepalanya oleh Mu’awiyah adalah Amr bin Hamaq sebagai Syi’ah Ali yang turut mengepung rumah Utsman dan dituduh membunuh Utsman dengan 9 tusukan. Ia melarikan diri ke Mada’in bersama Rifa’ah bin Syaddad dan terus ke Mosul

.

Ia ditangkap dan gubernur Mosul Abdurrahman bin Abdullah bin Utsman mengenalnya. Ia mengirim surat ke Mu’awiyah. Mu’awiyah menjawab seenaknya: “Ia membunuh Utsman dengan tusukan dengan goloknya (masyaqish) dan kita tidak akan bertindak lebih, tu suklah dia dengan sembilan tusu kan”. Setelah ditusuk ­baru tusukan pertama atau kedua, kelihatannya ia sudah mati­ kepalanya dipenggal dan dikirim ke Syam, diarak kemudian diserahkan kepada Mu ’awiyah dan Mu’awiyah mengirim kepala ini kepada istrinya Aminah binti al­Syarid yang sedang berada di penjara Mu’awiyah

.

Kepala itu dilemparkan ke pangkuan istrinya. Istrinya meletakkan tangannya di dahi kepala suaminya kemudian mencium bibirnya berkata:
Mereka hilangkan dia dariku amat lama,
Mereka bunuh dan sisakan untukku kepalanya,
Selamat datang, wahai hadiah,
Selamat datang, wahai wajah tanpa roma.
‘Amr bin Hamaq adalah orang pertama dalam sejarah Islam yang kepalanya dipenggal dan diarak dari kota ke kota, lihat Ibn Qutaibah, Al­Ma’ar if, hlm. 127; Al­Isti’ab, Jilid 2, hlm. 404; Al­Ishabah, jilid 2, hlm. 533; Ibn Katsir, Tarikh, jilid 8, hlm. 48

.

>> Abu Dzar dengan Muawiyah

Ketika Abu Dzar “disuruh” Uthman untuk ke Syria, ia malah melihat kegiatan Muawiyah lebih buruk dari Uthman dan Marwan. dan tak henti-hentinya ia berdakwah dan menegur ketidakberesan dalam pemerintahan Uthman. Ia pun dipanggil Muawiyah, Muawiyah berkata, Wahai musuh Allah! engkau menghasut orang menentang aku dan berbuat sesukamu. Apabila aku sampai membunuh sahabat nabi tanpa izin khalifah maka engkaulah orangnya.” Abu Dzar pun menjawab, “Saya bukan musuh Allah atau nabi-Nya. Justru kau dan ayahmulah yang musuh Allah. Kamu berdua masuk Islam secara lahiriah, sementara kekafiran masih tersembunyi dalam hatimu.” Ia tidak memperdulikan ancaman Muawiyah dan terus berdakwah kepada masyarakat Syria. Muawiyah lantas melaporkan kegiatan Abu Dzar pada Uthman

.

Motif Revolusi Husein
.
Ada banyak motif untuk revolusi Huseiniyah dan yang paling menonjol yang bersifat ideologis. Berikut ini adalah rinciannya:
.
Diantara banyak alasan, maka dekadensi moral umat Islam adalah yang paling mendesak untuk dipulihkan. Karena adanya suatu upaya sistematis untuk mendistorsi konsep-konsep dan gagasan Islam. Pemalsuan hadis adalah perilaku dan rahasia umum, yang memiliki efek beracun pada kehidupan kaum muslimin.
.
Kedok agama yang digunakan untuk menyembunyikan perilaku jahat dinasti Bani Umayah sangat membahayakan Islam sebagai agama. Dalam jangka panjang, hal ini bisa mengubah konsepkonsep Islam yang murni dan menjungkirbalikkan cita-cita sosial Islam. Oleh karena itu, ikhtiyar untuk menanggalkan topeng ini dan mengekspos citra  Bani Umayah sesungguhnya adalah suatu kebutuhan mendesak dan penting.
.
Struktur pemerintahan tidak dibangun atas konsep dasar Islam. Klaim kaum Quraisy bahwa mereka dilahirkan untuk memerintah dan non-Arab adalah warga negara kelas dua. Ini menunjukkan bagaimana gambaran struktur sosial  dari dunia Islam di bawah dinasti Bani Umayah. Kebebasan berpikir dan berekspresi ditolak. Ketika seseorang berani untuk mengungkapkan pendapat yang bertentangan dengan penguasa, maka penjara Umayyah akan
menjadi rumahnya, hartanya dirampok, dan bahkan hidupnyadipertaruhkan.
.
Dinasti Bani Umayah menganggap kekuasaan Islam menjadi property right mereka. Sejumlah kewajiban pajak-pajak Islam seperti sedekah, zakat dan pajak Islam lainnya dikumpulkan, namun dilarang mempertanyakan kemana uang itu dibelanjakan. Gratifikasi dan penyuapan diberikan kepada gubernur dan kepala suku dalam rangka menjamin loyalitas mereka. Sejumlah besar uang dihamburkan dengan sia-sia untuk balapan, perjudian, industri khamr, dan membeli budak perempuan untuk menghibur kaum aristokrat Umayah. Oleh karena itu, sementara mayoritas muslim bisa mati karena kelaparan, sisi lain kelompok yang berkuasa menikmati hak istimewa sosial dan material.
.
Pada titik kulminasinya seiring dengan berjalannya waktu, kaum muslimin telah terbiasa dengan regulasi anti-Islam model Bani Umayyah. Beberapa perlawanan dengan mudah ditaklukkan dan akhirnya beberapa kelompok umat mulai menyesuaikan diri dengan kondisi yang ada. Oleh karena itu, semangat revolusioner Islam mulai hilang secara bertahap dari kehidupan kaum muslimin. Oleh karenanya maka diperlukan stimulan baru untuk memompa jiwa dan memulihkan kembali kehidupan beragama mereka.
.
Pentahapan Revolusi
.
Deklarasi Imam Husain untuk melawan rezim Bani Umayyah tidak diragukan lagi. Selama perjalanan ke Karbala, ia tidak pernah berhenti mengajak orang untuk berjuang untuk menuntut citacita keadilan Islam, dan untuk berperang melawan penyimpangan perilaku. Dalam sambutannya di Karbala, dia mengutip ucapan Nabi (saww) yang mengatakan :
.
“Barangsiapa yang melihat penguasa kejam, melanggar hukum Allah, melanggar hukum-Nya, bertindak menyalahi sunah Nabi, kemudian dia tidak mencoba untuk mengubah penguasa itu dengan tindakan atau lisannya, maka Allah berjanji memberikan tempat yang layak di Neraka”
.
“Kini orang-orang Bani Umayyah telah berjanji setia kepada Iblis dan meninggalkan ketaatan kepada Allah.. Mereka telah menyebar korupsi, menangguhkan penerapan hukum Islam, dan merampas harta kaum muslimin untuk diri mereka sendiri. Mengharamkan yang dihalalkan dan menghalalkan apa yang diharamkan.
.
“Pidato Imam Husain bertujuan untuk membuka kedok agama rezim Umayyah itu. Beliau memperkenalkan dirinya kepada orangorang dan menyampaikan pesan kepada umat Islam. Kepribadian Imam Husain dan reputasi agamanya tidak perlu dipertanyakan. Maka tak heran kalau beliau membawa tugas besar, sementara orang banyak yang tidak siap untuk menyambutnya.
.
Suatu keunikan dari revolusi besar ini adalah bahwa Imam Husein as. Adalah  pemimpin yang telah memprediksi kematiannya sendiri bahkan sebelum menginjakkan kaki untuk melangkah. Namun beliau terus melaksanakan segala persiapan yang diperlukan dan berkampanye. Diantara pernyataan Imam Husain kepada orangorang di Mekah adalah:
“…Sebaik-baik hal bagiku adalah kematian yang akan kualami  Wahai manusia, aku melihat seolah-olah tubuhku akan dicabikcabik oleh serigala buas diantara Al-Nawasis dan Karbala. Lalu mereka mengisi kantong-kantong mereka yang kosong. Tidak ada lagi tempat pelarian dari kejaran takdir…”
.
Imam Husain dan para sahabatnya yang mulia berjuang dengan keberanian yang tiada banding. Pasukan beliau hanya tujuh puluh berjuang melawan ribuan orang dari tentara Yazid dengan pertempuran yang tidak seimbang. Tentara Umayyah menggunakan metode yang paling kejam dan tercela dalam memerangi kafilah kecil ini. Tentara Yazid telah mencegah kafilah ini dari air minum selama tiga hari, dan menyiksanya dalam panasnya padang pasir. Namun keteguhan iman Imam Husain as. dan pengikutnya tidak goyah dalam perjuangannya. Imam telah menyalakan api yang selalu bersinar dengan jihad melawan penyimpangan Islam dan menghancurkan mitos tentang kewajiban kesetiaan kepada rezim Umayyah yang menyimpang.
.
Hasil Revolusi Imam Husein as.
.
Apa maksud hasil revolusi Imam Husain? Banyak orang yang tidak paham dengan motivasi kebangkitan Imam Husein, dengan polosnya bertanya tentang hasil revolusi Imam Husein. Bahkan mempertanyakan keputusan Imam untuk melawan rezim Umayah yang dianggapnya sia-sia dan fatal.

.

Meskipun motif revolusi sudah dibahas, tapi disini kita dapat melihat secara singkat tentang perubahan yang terjadi di dunia Islam akibat revolusi Imam Husain sesuai pada tahapan ini :
.
Pembunuhan Imam Husain as. cucu Nabi adalah skandal besar bagi seluruh dunia Islam. Apalagi cara pembunuhan dan perlakuan yang diberikan kepada keluarganya yang memiliki derajat mulia. Akibatnya, mayoritas kaum muslimin berlepas diri dari perbuatan dan kebijakan rezim Umayyah. Dengan demikian, revolusi ini telah menjalankan tugas untuk mengungkap karakter rezim Umayyah yang jauh dari tuntunan Islam kepada masyarakat umum dan kini kaum muslimin tidak meragukan lagi tentang hakekat rezim Umayyah itu. Sebab program rezim Umayyah dalam rangka mendistorsi cita-cita Islam tidak mendapatkan animo lagi.
.
Revolusi Imam Husain telah membuka jalan untuk tugas umat Islam kedepan. Penderitaan panjang umat Islam berubah menjadi pertobatan massal dan kemudian ke pemberontakan terbuka terhadap rezim Bani Umayah itu. Dengan demikian, revolusi Imam Husein telah memberikan stimulan untuk memindahkan semangat dan mengaturnya dalam gerakan yang dinamis. Kemudian  gelombang gerakan Islam terjadi sepanjang sisa sejarah Islam. Serangkaian revolusi terealisasi berkat semangat revolusioner Imam Husain dan reformasi muncul pada interval waktu yang berurutan.
.
Dalam kesempatan ini kami menutup pembahasan ini dengan mengutip pandangan Syahid Murtadha Muthahari tentang keberhasilan yang dicapai dari kebangkitan Imam Husein ; “Akan tetapi, syahadah Imam Husain meniupkan hawa segar pada dunia Islam, mewujudkan perkembangan dahsyat dalam Islam. Dampak sosial ini karena Imam Husain as telah membangkitkan roh muslimin melalui gerakan kesyahidan. Beliau  telah menghidupkan tradisi syahadah di tengah masyarakat Islam, dan mengurangi perbudakan  yang mendominasi sejak akhir priode kepemimpinan Utsman dan memuncak pada zaman Muawiyah serta anaknya. Beliau  telah merubah perasaan takut menjadi berani. Singkatnya, bahwa beliau telah menganugerahkan identitas Islam pada masyarakat muslim.”

.

Sebagai penutup dapat disimpulkan bahwa tugas utama dan misi Imam Husein as. adalah untuk membangkitkan umat dan untuk membuat mereka menyadari bahwa kesialan sedang menunggu mereka jika tidak memiliki kepedulian atas nasib umat Islam. Misinya bukan hanya sekedar untuk mereformasi pemerintahan rezim despotis Umayah. Akan tetapi Imam Husain, bersama dengan nenek moyangnya membawa misi yang unik namun universal, yaitu: untuk melawan kebodohan dan menyelamatkan orang-orang agar tidak tersesat.

Paham JAMAAH, KEADiLAN SEMUA SAHABAT DAN PATUH MUTLAK PADA PENGUASA adalah produk pabrik hadits Bani Umaiyyah

Ditipu, Sahril Lapor Polisi



Imam Hasan as. dituduh banyak nikah. Menurut sebuah riwayat, ia telahmenikah dengan tiga ratus orang wanita

.

Semua itu hanyalah fitnah yang tidak berfakta. Tuduhan itu semata-mata rekayasa yang dibuat Manshûr Ad-Dawâniqî pada saat keturunan Imam Hasan as. mengadakan perlawanan terhadapnya; gerakan yang hampir saja menggoyahkan dan meruntuhkan dinasti kerajaannya. Manshûr telah berbuat dusta atas Imam Amirul Mukminin as. dan keturunannya dengan tuduhan-tuduhan palsu

.

Seandainya semua riwayat buatan itu benar, tentunya Imam Hasan as. mempunyai anak yang sangat banyak sesuai dengan bilangan istrinya itu. Namun kenyataannya, para ahli nasab berasumsi bahwa putra-putri Imam Hasan as. hanya berjumlah dua puluh dua orang. Hal ini sama sekali tidak sesuai dengan jumlah wanita yang mereka duga telah dinikahi Imam as

.

Selain itu, mereka juga menuduh Imam Hasan as. dengan banyaknya melakukan perceraian. Seandainya tuduhan itu benar, pasti ia telah men-cerai istrinya yang bernama Ja‘dah binti Asy‘ast. Kami telah membuk-tikan kepalsuan semua tuduhan itu dengan argumentasi yang gamblang dalam kitab kami, Hayâh Al-Imam Hasan as., jilid 2.

.
Diantara pokok perbedaan Sunni dan Syi’ah adalah persoalan kepemimpinan. Syi’ah mengklaim imamah (kepemimpinan umat) bersifat profetis, sakral dan menjadi bagian dari pokok agama (ushuluddin), sementara Sunni berangagapan sebaliknya imamah bersifat profane, secular, dan hanya merupakan bagian dari cabang agama (furu’uddin)
.
Kajian sejarah kepemimpinan Islam pasca kenabian menunjukkan bahwa terdapat korelasi kuat antara kepemimpinan Islam dan islam sebagai agama. Pilihan konsep kepemimpinan justru akan menentukan “tipe  Islam” yang dianut
.
Kontroversi Kepemimpinan Umat
.
Setelah empatpuluh tahun nabi wafat, kaum muslimin mengalami dekadensi, dan demoralisasi. Silih bergantinya kekuasaan para khalifah yang penuh kontroversi yang berakhir dengan pengukuhan Mu’awiyah bin Abu Sufyan, telah mengubah sistem kepemimpinan dari khalifah menjadi kerajaan.
.
Adalah sebuah gagasan penting untuk memahami mengapa terjadi suatu penindasan atas nama agama oleh dinasti Muawiyah.
.
Dalam Islam prinsip-prinsip pengelolaan kekuasaan politik diatur secara jelas, sebab kekuasaan poitik berhubungan dengan maslahat dan mudharat bagi umat Islam. Islam bukanlah agama individual yang berhenti pada aspek internalisasi ritual vertikal, atau dengan kata lain berhenti ketika seorang muslim telah melaksanakan ibadah ritual, yang mestinya setiap ritual dalam Islam memiliki dua aspek ; individual dan sosial sekaligus.
.
Diantara doktrin prinsip pengelolaan kekuasaan tersebut dapat ditemukan dalam beberapa ayat Qu’ran ;
1. Prinsip musyawarah dan problem solving (QS : 3 ; 159)
Maka disebabkan rahmat dari Allah-lah kamu Berlaku lemah lembut terhadap mereka. Sekiranya kamu bersikap keras lagi berhati kasar, tentulah mereka menjauhkan diri dari sekelilingmu. karena itu ma’afkanlah mereka, mohonkanlah ampun bagi mereka, dan bermusyawaratlah dengan mereka dalam urusan itu kemudian . Apabila kamu telah membulatkan tekad, Maka bertawakkallah kepada Allah. Sesungguhnya Allah menyukai orang-orang yang bertawakkal kepada-Nya
.
2. Prinsip Kedilan dan Emansipasi Hukum (Equality before the Law) (QS: 5;48)
Dan Kami telah turunkan kepadamu Al Quran dengan membawa kebenaran, membenarkan apa yang sebelumnya, Yaitu Kitab-Kitab (yang diturunkan sebelumnya) dan batu ujian terhadap KitabKitab yang lain itu; Maka putuskanlah perkara mereka menurut apa yang Allah turunkan dan janganlah kamu mengikuti hawa nafsu mereka dengan meninggalkan kebenaran yang telah datang kepadamu. untuk tiap-tiap umat diantara kamu, Kami berikan aturan dan jalan yang terang. Sekiranya Allah menghendaki, niscaya kamu dijadikan-Nya satu umat (saja), tetapi Allah hendak menguji kamu terhadap pemberian-Nya kepadamu, Maka berlombalombalah berbuat kebajikan. hanya kepada Allah-lah kembali kamu semuanya, lalu diberitahukan-Nya kepadamu apa yang telah kamu perselisihkan itu, (QS: 4;58)Sesungguhnya Allah menyuruh kamu menyampaikan amanat kepada yang berhak menerimanya, dan (menyuruh kamu) apabila menetapkan hukum di antara manusia supaya kamu menetapkan dengan adil. Sesungguhnya Allah memberi pengajaran yang sebaikbaiknya kepadamu. Sesungguhnya Allah adalah Maha mendengar lagi Maha melihat
.
 3. Prinsip Distribusi Ekonomi (QS: 59;7)
Apa saja harta rampasan (fai-i) yang diberikan Allah kepada RasulNya (dari harta benda) yang berasal dari penduduk kota-kota Maka adalah untuk Allah, untuk rasul, kaum kerabat, anakanak yatim, orang-orang miskin dan orang-orang yang dalam perjalanan, supaya harta itu jangan beredar di antara orang-orang Kaya saja di antara kamu. apa yang diberikan Rasul kepadamu, Maka terimalah. dan apa yang dilarangnya bagimu, Maka tinggalkanlah.  dan bertakwalah kepada Allah. Sesungguhnya Allah Amat keras hukumannya
.
4. Prinsip Partisipasi dalam kebijakan publik (QS: 3;104)
Dan hendaklah ada di antara kamu segolongan umat yang menyeru kepada kebajikan, menyuruh kepada yang ma’ruf dan mencegah dari yang munkar; merekalah orang-orang yang beruntung.Dinasti Muawiyah telah mendiskualifikasi seluruh prinsip pengelolaan kekuasaan diatas, karena memang tidak memiliki kepentingan untuk menjalankan prinsip-prinsip tersebut
.
Satu satunya prinsip yang diaplikasikan adalah meraih kekuasaan seluas-luasnya agar dapat dimanfaatkan sebesar-besarnya untuk keuntungan sendiri dan kaum ningrat kerabatnya.Untuk mencapai tujuan politiknya, dinasti muawiyah ini menjalankan beberapa program dan agenda politiknya sebagai berikut:
.
1. Intimidasi
Aksi teror terhadap umat Islam dijalankan terhadap mereka yang tidak memberikan konsensus atas otoritas politis Muawiyah. Teror dilakukan secara terorganisir melalui jaringan aparatur pemerintahan dan pejabat-pejabat gubernur di beberapa wilayah kekuasaannya. Teror ini  dilakukan dengan cara intimidasi, pemenjaraan, pembunuhan hingga peperangan.
.
Sementara pembunuhan tanpa alasan yang sah, dalam Islam memang merupakan kejahatan fatal, sebagaimana dalam ayat QS: 5;32 oleh karena itu Kami tetapkan (suatu hukum) bagi Bani Israil, bahwa: Barangsiapa yang membunuh seorang manusia, bukan karena orang itu (membunuh) orang lain atau bukan karena membuat kerusakan dimuka bumi, Maka seakan-akan Dia telah membunuh manusia seluruhnya dan Barangsiapa yang memelihara kehidupan .seorang manusia, Maka seolah-olah Dia telah memelihara kehidupan manusia semuanya. dan Sesungguhnya telah datang kepada mereka Rasul-rasul Kami dengan (membawa) keterangan-keterangan yang jelas, kemudian banyak diantara mereka sesudah itu  sungguh sungguh melampaui batas dalam berbuat kerusakan dimuka bumi.
.
Seperti kebanyakan penguasa otoriter, maka dinasti muawiyah pun membutuhkan pemerintahan yang kuat. Untuk tujuan ini maka umat Islam dipaksa untuk mendukung, menyokong dan jika perlu memuja otoritas muawiyah. Disisi lain, terhadap rakyat dipaksa untuk membantu menyingkirkan, mendiskreditkan dan menjatuhkan siapapun yang mengganggu otoritas muawiyah. Dalam sejarah disebutkan bahwa telah terjadi propaganda anti Imam Ali as. Dengan melakukan penghujatan dalam tiap akhir mimbar jum’at di masjid-masjid dalam wilayah kekuasaan mu’awiyah.
.
Salah satu skandal pembunuhan tokoh penting – terhadap sahabat nabi yang sangat dihormati – adalah pembunuhan terhadap Hujr ibn Adi dan para pengikutnya. Latar belakang pembunuhan tersebut adalah suatu upaya untuk menyingkirkan pengaruh Imam Ali as. Dan pengikutnya (syi’ah Ali), agar “stabilitas” pemerintahan dapat terkendali. Metode represif dalam pengendalian stabilitas tersebut adalah untuk menciptakan ketakutan-ketakutan dan membungkam kelompok-kelompok oposisi.
.
Sejarahwan telah merekam kisah-kisah yang dialami korban penindasan Muawiyah, diantaranya adalah yang terjadi pada ‘Amr bin Al-Hamaq Al-Khuzâ‘î. Allah memandang bahwa membunuh seseorang itu adalah sebagai membunuh manusia seluruhnya, karena orang seorang itu adalah anggota masyarakat dan karena membunuh seseorang berarti juga membunuh keturunannya
.
‘Amr bin Al-Hamaq Al-Khuzâ‘î Seorang pecinta dan pendukung Ahlul Bait Rasul. Dalam pelariannya ke kota moshil ‘Amr bin Al-Hamaq Al-Khuzâ‘î tertangkap kemudian dibawa dan dihadapkan kepada gubernur moshil Abdurrahman bin Abdullah bin Utsman Ats-tsaqofi. Setelah mendapat arahan dari Mu’awiyah, sang gubernur diperintahkan untuk mencambuk sebanyak lima kali. ‘Amr bin Al-Hamaq Al-Khuzâ‘î yang pada saat itu sakit, hanya dengan sekali cambuk langsung menemui ajalnya. Namun yang mengejutkan adalah setelah kematiannya kepala Amr dimutilasi. Kemudian kepala tersebut dibawa, dipertontonkan di pasar dari satu kota ke kota lain hingga berakhir di Damaskus. Inilah kepala pertama yang dikirim sebelum kepala Imam Husein as. Dan kepala para syuhada karbala.
.
2. propaganda
Disamping terror dan intimidasi, cara yang juga efektif untuk menyingkirkan lawan politiknya adalah dengan melakukan propaganda atau kampanye hitam demi untuk mempengaruhi opini publik. Dinasti Muawiyah menggunaakan pengaruh agitasi untuk mendiskreditkan Imam Ali as. secara massif selama dua abad.
.
Jika kita merujuk pada peradaban lain, terdapat hal yang sama. Di India kuno, menjelang tahun 400 SM di India, Kautilya seorang Brahmana yang diduga menteri besar dalam Kekaisaran Candragupta Maurya menulis Arthashastra (Prinsip-prinsip Politik), sebuah buku nasihat bagi para penguasa yang sering dibandingkan dengan Republic karya Plato dan The Prince karya Machiavelli
.
Kautilya membahas penggunaan perang psikologis (psywar) baik yang tebuka maupun rahasia dalam upaya mengganggu militer musuh dan merebut ibu kota. Ia menulis bahwa para propagandis raja harus menyatakan bahwa ia bisa mempraktekan sihir, para “Dewa” dan orang-orang bijak (intelektual) berada dipihaknya  dan bahwa semua orang mendukung tujuan perangnya yang akan meraih manfaat. Dalam cara-cara rahasia, agen-agen propagandis harus menyusup ke kubu musuh untuk menyebarkan berita yang salah ditengah rakyat di ibu kota, diantara kalangan pemimpin dan militer
.
Nasihat yang sama juga dilontarkan oleh Sun Tzu dalam karyanya Ping-fa (The Art of War) yang menulis pada periode sama. Bahwa “Semua perang berdasarkan pengelabuan. Oleh karena itu, ketika mampu menyerang, kita harus terlihat tidak berdaya, ketika kita menggunakan kekuatan, kita harus terlihat tidak aktif, ketika kita dekat, kita harus membuat percaya bahwa kita sangat jauh, ketika kita berada jauh, kita harus membuat mereka yakin kita dekat. Tahan musuh, munculkan kekakaucan dan serang mereka”
.
Rekayasa dan pemalsuan hadits untuk mendiskreditkan tokohtokoh Ahlul Bait dilakukan secara sistematis dengan tujuan untuk mendistorsi, merusak dan menjungkirbalikkan ajaran Islam yang dibawa olah nabi saww. Kemudian Bani umayah ingin mengganti Islam yang murni ini dengan Islam yang kompatibel / cocok dengan sistem kekuasaan Muawiyah
.
Ibn Abil Hadid al Mu’tazili menulis bahwa Muawiyah mendorong pengikutnya dan pendukungnya untuk meriwayatkan beberapa hadits yang memojokkan Imam Ali, diantaranya Abu hurairoh, Amr bin Ash, Mughirah bin Syu’bah dan Urwah bin Zubair
.
3 Kesenjangan ekonomi
Demi tercapainya kekuatan pemerintahan muawiyah, maka sumber ekonomi umat harus dikuasai dan dimonopoli. Dalam konteks pemerintahan muawiyah distribusi kesejahteraan masyarakat disesuaikan dengan tingkat loyalitas masyarakat terhadap otoritas muawiyah. Makin setia, maka akan makin sejahtera Dengan kebijakan ini maka prinsip-prinsip keadilan ekonomi yang tertuang dalam QS; 59:7 telah dicampakkan. Hasilnya tentu saja kesenjangan ekonomi yang semakin  melebar
.
Sejarahwan muslim telah mencatat keadaan ekonomi pada masa awal dinasti Muawiyah, telah terjadi kesenjangan ekonomi yang dalam antara golonagan kaya (kaum aristocrat) dan kaum miskin (umat Islam). Kendatipun kondisi ini telah tercipta pada masa khalifah Utsman ibn Affan dengan kebijakan ekonominya yakni “ekonomi kekeluargaan”. Maka pengangkatan pejabat politik wilayah yang berbau nepotisme telah menjadi pintu masuk dari kondisi struktur ekonomi yang timpang
.
Posisi Imam Ali as. Sebagai khalifah penggantinya yang banyak mereformasi struktur pemerintahan, pengelolaan administrasi baitul maal ternyata hanya merupakan selingan dari transformasi Utsman bin Affan kepada Mu’awiyah bin Abu Sufyan
.
Muawiyah menempatkan Amr ibn Ash sebagai gubernur Mesir, dan para sejarahwan mencatat harta kas Amr senilai 325.000 Dinar dan 1.000 dirham60, lahan pertanian senilai 200.00 dinar, Istana di al-What Mesir senilai 10.000 dinar. Marwan bin Hakam mendapat 500.000 Dinar yang bersumber dari pengumpulan pajak di wilayah Afrika juga memiliki rumah-rumah mewah. Sa’ad bin Abi Waqash meninggalkan warisan harta sejumlah 250.000 dirham, demikian pula dengan Zaid bin Tsabit telah mweninggalkan rumah-rumah mewah senilai 100.000 dinar. Disisi lain kerawanan pangan, kelaparan, dan kemiskinan melanda umat Islam. Pemerintahan Muawiyah tidak saja mengabaikan kondisi ini, namun juga tanpa belas kasih memelihara diskriminasi ekonomi untuk tujuan kelanggengan kekuasaannya
.
Sebagaimana telah ketahui luas bahwa pemerintahan nepotism Bani Umawiyah ini telah dimulai sejak masa Utsman bin Affan. Rezim inilah yang telah dengan sengaja by design membagi kelas social masyarakat Islam menjadi dua strata ; kelas bangsawan dan kelas rakyat jelata
.
Seorang sahabat nabi bernama Abi Dzar al Ghifari mengomentari kondisi yang terjadi dimasa Utsman bin Affan ; “ Saya heran mengapa orang yang tak punya makanan dirumah tidak menghunuskan pedang dan menyerang orang-orang itu. Ketika kemiskinan datang ke suatu kota, maka kekafiran akan meminta untuk mengambilnya sendiri.”
.

wajah politik Mu‘âwiyah yang dengan terang-terangan menentang Al-Qur’an dan Sunah Rasulullah saw. Ia membunuh orang-orang yang tidak berdosa dan orang-orang saleh seperti: Hujr bin ‘Adî, ‘Amr bin Al-Hamaq Al-Khuzâ‘î, dan para sahabat yang lain secara zalim. Dia juga merusak kehormatan kaum muslimin, menawan kaum wanita, merampas harta benda, dan mengangkat orang-orang bejad sebagai aparat peme-rintahannya seperti: Ibn ‘Ash, Ibn Syu‘bah, Ibn Arthah, Ibn Hakam, Ibn Marjânah, dan Ibn Sumayyah

.

Orang terakhir ini telah dipisahkan oleh Mu‘âwiyah dari ayahnya yang sah, yaitu ‘Ubaid Ar-Rûmî, kemudian menisbahkan kepada ayahnya sendiri yang durjana, Abu Sufyân. Dia telah memberikan kekuasaan untuk memerintah penduduk Syi‘ah Irak kepada anak durjana ini. Dengan kekuasaannya itu, Ibn Sumayyah telah membebankan berbagai kesengsaraan kepada rakyat di sana, menyem-belih anak-anak mereka, mempermalukan kaum wanita mereka, memba-kar rumah-rumah mereka, dan merampas harta benda mereka ..

.

Salah satu kejahatan dan kezaliman Mu‘âwiyah yang terbesar ialah usahanya membunuh cucu Rasulullah saw., Imam Hasan as. Dia telah menyusupkan racun untuk Imam Hasan as. melalui tangan istrinya yang bernama Ja‘dah bin Asy‘ats. Dia merayu Ja‘dah dan berjanji akan menikahkannya dengan Yazîd. Ja‘dah terkutuk itu membubuhkan racun sementara Imam Hasan as. sedang berpuasa. Racun itu merobek-robek usus Imam Hasan as. dengan cepat. Tidak lama setelah itu, rohnya yang suci segera kembali ke haribaan Tuhannya dengan membawa berbagai musibah, duka, dan kesedihan yang ditimpakan oleh Mu‘âwiyah. Innâ lillâhi wa innâ ilaihi râji‘ûn!

.

Mu‘âwiyah melengkapi kejahatan dengan mengangkat anaknya sen-diri, Yazîd, sebagai khalifah Muslimin. Anak ini telah merusak dan meng-hancurkan Islam dan umatnya. Tak ada kejahatan yang disisakannya. Di antara kejahatannya yang terbejat adalah tragedi Thuff di Mekah dan tragedi Harrah, serta berbagai petaka lainnya yang telah mengubah kehidupan Muslimin menjadi neraka Jahanam yang sulit dibayangkan.[]

.
Legitimasi Agama 
Muawiyah menyadari bahwa seluruh agenda politik seperti intimidasi, propaganda, monopoli ekonomi, dalam rangka penguatan kekuasaannya, tidak akan dapat dijalankan tanpa ada legitimasi agama. Mengingat masa kekuasaannya adalah masa yang tidak terlalu jauh dengan masa kenabian, dan banyak diantara para sahabat nabi masih hidup. Maka untuk menghindari kritik atas pelaksanaan pemerintahan yang diarahkan pada dirinya, Muawiyah mencoba untuk membungkam kelompok kritis yang berseberangan dengannya, dengan cara penyuapan atau jika tak dapat disuap diintimidasi
.
Muawiyah menghimpun intelektual bayaran yang terdiri dari kelompok penyair, tukang cerita, dan ulama bayaran. Tugas mereka tak lain adalah menjaga “stabilitas” pemerintahan dengan cara memberikan legitimasi keagamaan atas kebijakan publiknya.Pada masa inilah kemudian muncul dan berkembang paham teologi yang di rekayasa oleh para elite intelektual gadungan atas sponsor Muawiayah. Bahkan paham ini telah sangat jauh melenceng dari spirit ajaran Islam paling fundamental, Diantara sebagian paham-paham itu adalah ;
.
a. Paham fatalis (jabariyah)
Paham ini percaya bahwa semua peristiwa terjadi memang sudah ditetapkan kejadiannya jauh sebelum penciptaan alam semesta, sehingga manusia tak sanggup untuk mengubah nasibnya sendiri. Muawiyah adalah orang yang menghidupkan keyakinan ini. Qadhi Abdul Jabbar mengutip perkataan Muawiyah “Perkara Yazid ini merupakan takdir Allah dalam perkara ini kita tidak memiliki kehendak atau pilihan. ”Pada satu kesempatan Ubaidullah bin Ziyad bertanya pada Imam Sajjad ; “Bukankah Allah yang membunuh Ali Akbar?” “Orang (manusia) yang membunuh kakaku” Jawab Imam Sajjad. Paham ini, disatu sisi bertujuan untuk mengokohkan legitimasi pemerintahan Muawiyah, disisi lain betujuan untuk membelokkan umat Islam dari aqidah jihad dan amar ma’ruf nahi mungkar dengan pola pengingkaran umat Islam terhadap taklif (tanggung jawab keagamaan)
.
b. Paham Jama’ah
Suatu ketika Ibn Ishak melihat Syimr ibn dzil-Jaushan (pembunuh Imam Husein) shalat di masjidil haram dan berdoa ; “Ya Allah Engkau sungguh tahu bahwa aku ini bermartabat, karena itu ampunilah aku” Ibn Ishak menyela ; “mana mungkin diampuni, kalau ternyata kamulah orangnya yang membantu pembunuhan putra Nabi !” “Apa yang telah kami lakukan?” tukas Syimr. “Itu adalah perintah komandan kami, kami tak dapat menolak,  jika tidak dilaksanakan maka kami lebih rendah kedudukannya disbanding binatang buas!” Ibnu Ziyad ketika melakukan briefing kepada tentaranya sebelum peristiwaw pembantaian di Karbala, menegaskan ; “Jangan sampai lupa ketaatan dan persatuan, jangan sekalisekali ragu untuk membunuh orang yang memisahkan diri dari agama dan terlibat konflik dengan ‘Imam’ (Muawiyah).”  Pada awalnya istilah bay’ah (perjanjian) merupakan konsensus dan pengakuan sukarela atas pengemban otoritas politis terhadap umat Islam yang didasarkan pada kapasitas, kualifikasi kepemimpinan  dan tuntunan ilahiyah. Namun konsepsi ini diselewengkan pihak Muawiyah dari sebuah ‘konsensus’ menjadi sebuah ‘paksaan’, dari kepemimpinan berkapasitas profetis menjadi kepemimpinan berkapasitas bandit
.
Pergeseran esensi konsep kepemimpinan ini telah terjadi sejak kontroversi penetapan Khalifah pertama, dan berpuncak pada syahadah Imam Husein as. Dinamika awal kepemimpinan Islam pasca kenabian menunjukkan korelasi kuat antara kepemimpinan Islam dan islam sebagai agama. Pilihan konsep kepemimpinan justru akan menentukan “tipologi  Islam” yang dianut
.
Dalam AlQur’an, Allah berfirman (QS; 4:59) ;  Hai orang-orang yang beriman, taatilah Allah dan taatilah Rasul (Nya), dan ulil amri di antara kamu. kemudian jika kamu berlainan Pendapat tentang sesuatu, Maka kembalikanlah ia kepada Allah (Al Quran) dan Rasul (sunnahnya), jika kamu benar-benar beriman kepada Allah dan hari kemudian. yang demikian itu lebih utama (bagimu) dan lebih baik akibatnya.
.
Ayat di atas berkaitan dengan salah satu isu Islam yang paling penting, yaitu masalah kepemimpinan ilahiyah. Jadi pada prinsipnya, kepemimpinan adalah kunci rahasia bagi kemajuan dan kemunduran kemanusiaan. Seorang pemimpin yang lemah dan tidak berkompeten akan menyesatkan rakyat dan membawanya kepada kehancuran, sedangkan pemimpin yang kuat dan berkompeten akan memimpin rakyat menuju kesejahteraan material dan spiritual. Sebuah kepemimpinan yang benar akan membuka jalan bagi yang berpotensi untuk berkembang, sedangkan kepemimpinan palsu akan menghancurkan potensi umat.
.
Intisari ajaran yang tertuang pada ayat diatas terdiri dari tiga tahap : tahap pertama, memerintahkan orang beriman untuk taat kepada Allah, karena Dia adalah sumber dari semua jenis ketaatan, maka kepemimpinan harus datang dari yang Maha Perkasa. Pada tahap kedua ia memerintahkan orang percaya untuk mengikuti dan menaati Rasul-Nya, Nabi saww. yang sempurna dan tidak bertindak sesuai dengan keinginan pribadinya.
.
Pada tahap ketiga dan terakhir Ia memerintahkan orang beriman untuk mematuhi otoritas kepemimpinan Ulul amri, Mereka adalah yang berasal dari kalangan masyarakat muslim yang menjaga Islam dari aspek material dan spiritual dari kehidupan seorang muslim. Namun siapakah mereka yang dapat disebut sebagai pemangku otoritas Ulil Amri?
.
Konsep Kepemimpinan dan Islam
.
Mayoritas ulama Sunni dan para penafsir Quran memandang Ulul-Amri adalah penguasa dan negarawan pada setiap zaman.  Akibatnya, setiap muslim berkewajiban untuk mematuhi mereka sebagai-pemerintah, apapun esensi pemerintahan mereka adil atau zhalim
.
Meskipun ini pendapat tradisional yang umum dari para ulama Sunni, namun ada beberapa pemikir kontemporer dan intelektual  Sunni yang telah menolak pendekatan tradisional dan menegaskan bahwa “kita berkewajiban untuk mematuhi mereka dengan syarat  bahwa mereka tidak melanggar aturan Islam dan hukum”. Sayid Quthb dalam tafsirnya, Fi zhilalil Qur’an. Ini adalah contoh pendekatan baru dalam menerjemahkan konsep kepemimpinan
.
Legitimasi pendekatan tradisional atas Ayat Ulul Amri (misal QS; 4:59) dalam kutipan sebelumnya adalah memerintahkan kita untuk benar-benar taat kepada Allah, Rasul-Nya, dan Ulul-Amr tanpa syarat mempertanyakan kualifikasi Ulul Amri yang dimaksud. Alasannya adalah, bahwa ketidaktaatan kepada “pihak berwenang” di atas dapat mengganggu stabilitas dan ketenangan umat. Konsep serupa dapat kita bandingkan dengan pasal-pasal dari UndangUndang Subversi warisan kolonialis
.
Justifikasi lain yang merupakan salah satu sebab utama adalah bahwa banyak Hadis yang diklaim sebagai dikutip dari Nabi yang menyatakan bahwa para penguasa harus dipatuhi, terlepas dari perilaku mereka dan kualifikasinya
.
Hadis tersebut dibuat dalam skala besar diproduksi dalam pabrik hadis. Industri hadis ini didirikan pada masa pemerintahan dinasti Mu’awiyah. Tujuan dari pabrikasi tersebut, adalah pembenaran kepemimpinan palsu mereka untuk menyesatkan umat Islam
.
Berikut ini adalah beberapa contoh produk hadits Bani Umaiyah :
Diriwayatkan dari Huzhaifah bahwa Nabi telah berkata: “Akan ada penguasa setelahku, yang mereka tidak mengikuti sunahku. Di antara mereka ada yang hatinya seperti hati setan dalam tubuh manusia” Huzhaifah Kemudian bertanya pada Nabi tentang apa yang harus ia lakukan? Nabi menjawab: “Dengarkan dan ikuti penguasa anda, meskipun ia merampas harta benda dan ternak anda” (Muslim 6: 21).
.
Diriwayatkan dari Ibn-Abbas telah dikutip dari Nabi mengatakan:  “Barangsiapa melihat pemimpinnya sesuatu yang menjijikkan darinya, ia harus bersabar, karena siapa saja yang pergi satu langkah atau satu rentang dari mayoritas jama’ah maka dia akan mati dalam keadaan mati jahiliyah. “ Berdasarkan hadits-hadits diatas, seorang ulama Sunni yang bernama Abubakar Ibn Arabi telah menegaskan dalam bukunya Al-Awasim bahwa: “(Imam) Husain dibunuh oleh pedang kakeknya (maksudnya hadits-nya), karena ia memberontak terhadap Imam (Yazid)”.
.
Diriwayatkan dari Abdullah bin Umar yang dikutip dari Nabi telah berkata: “Barangsiapa mendurhakai pemerintahannya, ia akan bertemu dengan Allah di akhirat sedangkan dia tidak memiliki bukti atas apa yang telah dilakukan, dan orang yang meninggal tanpa memiliki kesetiaan dari pemerintah ia telah meninggal dan mati Jahiliyah (non-Muslim)” (Muslim 6:20) Abdullah Ibn Umar mengutip hadits tersebut setelah pembantaian yang terjadi di Harra,
Madinah tiga tahun setelah peristiwa Asyura di Karbala.
.
Imam Nawawi dalam syarahnya berkata dalam penjelasan dari hadis tersebut di atas:
“Semua ulama yang ahli hukum Sunni, perawi dan teolog telah sepakat bahwa khalifah tidak akan jatuh karena korupsi dan kesalahan dan pengabaian kepentingan publik. Jadi tidak ada yang diperbolehkan untuk bangkit melawan dia (penguasa zhalim). Paling banter hal yang diizinkan adalah memberi beberapa nasihat dan menakut-nakuti dia dari azab Allah, karena Hadis mengatakan kepada kita untuk melakukannya.
.
Sepanjang sejarah Islam, ulama Sunni telah telah berperan dalam melakukan pengelabuan terhadap kaum muslimin, disebabkan oleh ketergantungan mereka pada industri pemalsuan hadits produk Mu’awiyah. Mereka berdoa di belakang siapa pun yang memimpin  doa, mereka berbay’at kepada siapa pun penguasa mereka. Kemudian disisi lain kaum Syi’ah dituduh menjadi pemberontak dan teroris.
.
Banyak kejahatan dalam sejarah Islam yang dibenarkan oleh doktrin palsu tersebut. Masa  Yazid dalam peristiwa Harra di kota suci Nabi saaw., pembantaian ratusan umat Islam Madinah yang tidak bersalah menjadi saksi sejarah. Kota suci Nabi saww. Telah dilanggar kesuciannya, dimana telah terbunuh 700 diantaranya adalah mereka yang hafal Quran, 1000 anak perempuan diperkosa dan harta mereka dirampas selama tiga hari oleh tentara Yazid,semua di bawah legitimasi mematuhi khalifah.
.

.

Mu‘âwiyah telah menetapkan beberapa jurus politiknya berikut ini:

  1. Melakukan teror terhadap tokoh-tokoh Islam seperti Hujr bin ‘Adî, Maitsam At-Tammâr, Rasyîd Al-Hijrî, ‘Amr bin Al-Hamaq Al-Khuzâ‘î dan tokoh-tokoh besar lainnya. Para tokoh Islam ini telah dibantai, karena mereka adalah manifestasi kekuatan yang menen-tang kekuasaannya dan menghalang-halangi alur politiknya yang telah ia lempangkan atas dasar kezaliman dan diktatoris.
  2. Menghapus kemuliaan Ahlul Bait yang merupakan poros kesadaran sosial dalam Islam dan urat nadi yang penting di dalam tubuh umat yang senantiasa membantu mereka untuk bangkit dan melakukan perlawanan. Oleh karena itu, Mu‘âwiyah mewajibkan umat Islam untuk mencerca mereka dan menjadikan kebencian kepada mereka sebagai bagian dari kehidupan Islam. Dalam hal ini, Mu‘âwiyah telah menggunakan sarana pendidikan dan pengajaran, juga sarana ceramah dan bimbingan demi menghapus kemuliaan Ahlul Bait as. Bahkan Mu‘âwiyah mewajibkan masyarakat Islam untuk mengutuk Ahlul Bait di atas mimbar-mimbar pada salat Jumat, salat hari raya Idul Fitri, Idul Adha, dan pada kesempatan-kesempatan lainnya.
  3. Mengadakan perubahan atas realita Islam dan seluruh ajaran dan pondasinya. Mu‘âwiyah telah membentuk lembaga untuk membuat hadis-hadis palsu atas nama Rasulullah saw. Para pembuat hadis-hadis palsu itu telah berbuat dusta yang bertentangan dengan akal dan jalur kehidupan. Dan sangat disayangkan bahwa hadis-hadis palsu tersebut tercantum pula di dalam sebagian kitab-kitab sahih dan lainnya sehingga para ulama yang memiliki kepedulian terhadap ajaran Islam terpaksa menulis kitab yang menjelaskan hadis-hadis palsu tersebut. Menurut anggapan saya, kejahatan ini merupakan tragedi yang paling besar bagi umat Islam. Karena hingga saat ini, sebagian umat Islam masih banyak yang berpegang teguh kepada hadis-hadis palsu tersebut dan mereka meyakini bahwa hal itu merupakan bagian dari agama mereka. Padahal agama berlepas tangan dari semua itu.

Peringatan Imam Husain as. kepada Mu‘âwiyah

Imam Husain as. memberikan peringatan keras terhadap Mu‘âwiyah. Dalam peringatan itu, ia menolak politik kotor Mu‘âwiyah yang menen-tang kitab Allah dan sunah Nabi-Nya. Ia juga menegur pembunuhan yang dilakukannya terhadap para pemuka Islam. Peringatan Imam Husain as. tersebut merupakan dokumentasi politik penting yang mene-barkan berbagai kejahatan dan kezaliman Mu‘âwiyah. Hal ini telah kami jelaskan dalam buku kami, Hayâh Al-Imam Husain as

.

Seminar Politik di Mekah

Imam Husain as. pernah mengadakan seminar politik umum tahunan di Mekah. Dalam seminar itu, ia mengundang para jamaah haji, baik dari ka-langan Muhajirin maupun Anshar, dan jamaah haji lainnya. Ia menyam-paikan ceramah mengenai berbagai bencana dan cobaan yang menimpa keluarga Rasulullah saw. pada masa pemerintahan Mu‘âwiyah sang tiran

.

Berikut ini adalah cuplikan pidato Imam Husain as. dalam seminar tersebut:

Sesungguhnya si penguasa tiran ini—yakni Mu‘âwiyah—telah memperlakukan kami dan Syi‘ah kami dengan kejahatan seba-gaimana yang kalian lihat, saksikan, dan ketahui. Kali ini, aku ingin menanyakan sesuatu kepada kalian. Jika aku benar, maka benarkanlah aku, dan jika aku berdusta, maka dustakanlah aku. Dengarkanlah ucapanku dan tulislah perkataanku, kemudian kembalilah kalian ke tempat tinggal dan kabilah kalian. Ajaklah orang-orang yang kalian percaya dan kalian anggap jujur untuk mengetahui hak-hak kami sebagaimana yang kalian ketahui. Sesungguhnya aku merasa khawatir persoalan ini akan sirna dan terkalahkan. Tetapi Allah swt. akan menyempurnakan cahaya-Nya walaupun orang-orang kafir membencinya

.

Imam as. mengakhiri seminar itu dengan menjelaskan keutamaan-keutamaan Ahlul Bait as. dan upaya Mu‘âwiyah untuk menghapuskannya. Muktamar ini adalah muktamar pertama yang pernah diadakan dalam Islam

.

Penolakan Imam Husain as. Terhadap Kekhalifahan Yazîd

Mu‘âwiyah berusaha keras untuk mengangkat anaknya, Yazîd, untuk menjadi khalifah muslimin. Ia memanfaatkan seluruh sarana negara agar kekhalifahan dan kerajaan tersebut dapat dipegang oleh keturunannya. Imam Husain as. adalah orang yang paling keras menolak dan menentang upaya tersebut. Karena Yazîd sama sekali tidak memiliki kelayakan untuk menjadi khalifah muslimin. Imam as. menjelaskan sifat-sifat Yazîd dengan ucapan: “Sesungguhnya dia (Yazîd) adalah peminum arak dan pemburu binatang. Dia senantaisa menaati setan dan meninggalkan perintah Ar-Rahmân. Dia menampakkan kerusakan, menghapus hukum-hukum Allah, menghalalkan apa yang telah diharamkan Allah, dan meng-haramkan apa yang telah dihalalkan Allah.”

Setiap kali Mu‘âwiyah berusaha meyakinkan Imam Husain as. untuk membaiat Yazîd, Mu‘âwiyah tidak pernah menemukan peluang untuk itu

.

Kematian Mu‘âwiyah

.

Ketika penguasa tiran Mu‘âwiyah telah mati, Walîd, penguasa kota Madinah, memanggil Imam Husain as. supaya berbaiat kepada Yazîd. Imam Husain as. menolak permintaan tersebut seraya berkata: “Hai Amir, sesungguhnya kami keluarga kenabian adalah sumber risalah dan tempat para malaikat datang silih berganti. Dengan perantara kami Allah membuka risalah kenabian dan dengan kami pula Dia menutup kenabian. Sesungguhnya Yazîd adalah orang fasik, peminum khamar, pembunuh orang-orang tak bersalah, dan berbuat kefasikan secara terang-terangan. Orang sepertiku ini tidak akan membaiat orang seperti dia.”

.

Imam Husain as. menolak untuk membaiat Yazîd, sebagaimana seluruh keluarga kenabian juga menolak untuk membaitnya karena mengikuti pemimpin mereka, Imam Husain as

.

.

>> Ali dengan Mu’awiyah cs
Az­Zamakhsyari dalam Rabi’al­Abrar dan Suyuthi menceritakan: ‘Di zaman Umayyah lebih dari 70.000 mimbar digunakan untuk melaknat Ali bin Abi Thalib’. Mimbar­mimbar ini menyebar di seluruh wilayah dari ufuk Timur ke ufuk Barat. Al­Hamawi berkata: Ali bin Abi Thalib dilaknat di atas mimbar­mimbar masjid dari Timur sampai ke Barat kecuali masjid jami’ di Sijistan”. Di masjid ini hanya sekali terjadi khatib melaknat Ali. Tetapi pelaknatan di mimbar Haramain, Makkah dan Madinah, berjalan terus’

.

Mughirah bin Syu’bah yang jadi gubernur di Kufah menyuruh jemaah masjid mengutuk Ali dengan kata­kata: ‘Wahai manusia, pemimpinmu menyuruh kepadaku untuk melaknat Ali, maka kamu laknatilah dia’. jemaah berteriak ‘Mudah­mudahan Allah melaknati dia!’. Tetapi dalam hati, yang mereka maksudkan dengan ‘dia’ adalah Mughirah. Pelaknatan Mughirah terhadap Imam Ali dilakukan terus menerus. Sekali ia mengatakan dalam khotbahnya: ‘Sesungguhnya Rasul Allah saw tidak menikahkan putrinya dengan Ali karena Rasul menyukai Ali, tetapi untuk memperbaiki hubungannya dengan keluarga Abu Thalib’. Pada suatu ketika ia ditegur sahabat Zaid bin Arqam: ‘Hai Mughirah, apakah engkau tidak tahu bahwa Rasul saw melarang mencerca orang yang sudah mati? Tidakkah engkau melaknat Ali dan ia sudah meninggal?

.

Amir bin Sa’ad bin Abi Waqqash yang berkata: Mu’awiyah berkata kepada Sa’d: ‘Apa yang menghalangimu melaknat Abu Turab?’. Sa’ad menjawab: ‘Ada tiga hal yang diucapkan RasulAllah saw sehingga aku tidak akan pernah mencacinya, karena bila saja aku mendapat satu dari tiga keutamaan itu aku lebih suka dari pada memiliki harta apa saja yang paling berharga. Kemudian ia menyebut hadis al-­Manzilah, ar-­Rayah (bendera) dan al-­Mubahalah

.
Dalam lafal Thabari: ‘Tatkala Mu’awiyah naik haji, ia berthawaf bersama Sa’ad dan setelah selesai, Mu’awiyah pergi ke Dar an­Nadwah dan mengajak Sa’ad duduk bersama di ranjangnya (sarir) dan Mu’awiyah mulai memaki Ali, Sa’ad bangkit dan berkata: ‘Engkau mengajak aku duduk bersama di ranjangmu kemudian engkau memaki Ali, demi Allah bila aku dapat satu saja yang didapat Ali aku lebih suka dari apa yang dapat didatangkan matahari’? sampai ia selesai mengemukakan hadis dan Sa’ad bicara: ‘Demi Allah aku tidak akan memasuki rumahmu!’

.
Meskipun Sa’d bin Abi Waqqash tidak mau membaiat Ali, tetapi ia tidak dapat berdiam diri dan menegur Mu’awiyah. Bila ada Sa’ad, satu dari enam anggota Suyura, Muawiyah tidak berani melaknat Ali. Tatkala ia akan berkhotbah di masjid Nabi dan akan melaknat Ali, Sa’ad berkata: ‘Bila engkau melaknat Ali aku pasti keluar dari masjid’. Sa’ad bin Abi Waqqash, setelah meninggalnya Utsman, hidup menyendiri. Pertemuannya dengan Mu’awiyah hampir selalu terjadi di masjid. Ia memanggil Mu’awiyah sebagai raja dan bukan khalifah. Setelah Ali meninggal, hanya ia seorang diri lagi yang anggota syura dan selalu mengatakan kesalahannya tidak membaiat Ali. ‘Saya telah mengambil keputusan yang salah. Dan tatkala orang menyalahkannya karena tidak mau mendukungnya memerangi Ali ia berkata: ‘Saya menyesal tidak memerangi al­fi’ah al­bighiah, kelompok pemberontak (yaitu Mu’awiyah)

.
Demikian pula dengan Abdullah bin Umar, meski tidak membaiat kepada Ali pada akhirnya berkata: ‘Saya tidak pernah menyesal hidup di dunia, kecuali tidak berperang bersama Ali bin Abu Thalib melawan kelompok pemberontak sebagaimana diperintahkan Allah’

.

Pada satu hari Muawiyah sedang duduk-duduk dengan teman-temannya. Ahnaf bin Qais juga hadir. sementara itu seorang Syria datang lalu berpidato. pada akhir pidatonya ia mencerca Ali. mendengar itu Ahnaf berkata kepada Muawiyah, tuan! bila orang ini mengetahui bahwa anda akan merasa senang bila para Nabi dikutuk maka ia pun akan mengutuk mereka. Takutlah kepada Allah dan janganlah mengusik-usik Ali lagi. Ia sudah menemui Tuhannya. ia sekarang sendirian di kuburnya dan hanya amalnya yang menyertainya. Saya bersumpah demi Allah bahwa pedangnya sangat suci dan pakaiannya pun sangat bersih dan rapi, tragedi yang menimpanya besar

.
Muawiyah berkata, “Hai Ahnaf! engkau telah menaburkan debu ke mata saya dan berkata sesukamu. Demi Allah, engkau harus naik ke mimbar dan melaknat Ali. bila engkau tidak melaknatnya dengan sukarela maka engkau akan dipaksa melakukannya. Ahnaf menjawab, “Sebaiknya anda memaafkan saya dari melakukannya. namun meskipun anda memaksa saya, saya tetap tidak akan mengucapkajn kata-kata semacam itu. lalu Muawiyah menyuruhnya naik ke mimbar. Ahnaf berkata, Bila saya naik ke mimbar maka saya berlaku jujur. Muawiyah berkata, Bila engkau jujur, apa yang akan kau ucapkan? Ahnaf menjawab, “setelah naik ke mimbar maka saya akan memuji Allah lalu berkata begini, “Wahai manusia! Muawiyah telah menyuruh saya untuk mengutuk Ali. Tiada ragu bahwa Ali dan Muawiyah saling bermusuhan. Masing-masing mengaku bahwa pihaknya yang telah dizalimi. Oleh karena itu bila saya berdoa, hendaklah anda sekalian mengamininya” lalu saya akan berkata, “Ya Allah! Kutuklah salah satu dari kedua orang ini yang durhaka, dan biarkanlah para malaikat, nabi-nabi serta seluruh makhluk-Mu mengutuknya. Ya Allah! Limpahkanlah kutukan-Mu kepada kelompok pendurhaka. Wahai hadirin, ucapkanlah Amin. Wahai Muawiyah, saya tidak akan mengucapkan apa-apa selain kata-kata ini, walaupun saya harus kehilangan nyawa saya. Muawiyah menjawab, “Ya, kalau bbegitu aku memaafkanmu (dia naik ke mimbar dan mengutuk)

.

Mengenai alasan pelaknatan Ali bin Abi Thalib, dapat dijelaskan dengan riwayat dari Umar Bin Abd al-Aziz berikut ini: Pada waktu itu ayahku adalah gubernur di Makkah. Aku mendengar ayahku bicara lancar sampai pada saat ia melaknat Ali dan suaranya jadi tidak jelas, terbata­bata dan menyesakkan, hanya Allah yang tahu. Dan aku terheran­heran melihat yang demikian itu. Maka suatu hari aku bertanya kepadanya: ‘Wahai ayah, engkau berkhotbah begitu fasih dan lancar, belum pernah aku lihat engkau berkhotbah begitu baik, tetapi setelah engkau sampai pada melaknat lelaki itu engkau lalu tergagap-­gagap tidak karuan. ‘Ayahku menjawab: ‘Wahai anakku, andaikata orang Syam atau siapa saja yang berada di bawah mimbar mengetahui keutamaan lelaki ini seperti yang diketahui ayahmu ini, maka tiada seorang pun akan mengikuti kita”

.

>>Amr bin Hamaq vs Mua’wiyah
Orang pertama yang dipenggal kepalanya oleh Mu’awiyah adalah Amr bin Hamaq sebagai Syi’ah Ali yang turut mengepung rumah Utsman dan dituduh membunuh Utsman dengan 9 tusukan. Ia melarikan diri ke Mada’in bersama Rifa’ah bin Syaddad dan terus ke Mosul

.

Ia ditangkap dan gubernur Mosul Abdurrahman bin Abdullah bin Utsman mengenalnya. Ia mengirim surat ke Mu’awiyah. Mu’awiyah menjawab seenaknya: “Ia membunuh Utsman dengan tusukan dengan goloknya (masyaqish) dan kita tidak akan bertindak lebih, tu suklah dia dengan sembilan tusu kan”. Setelah ditusuk ­baru tusukan pertama atau kedua, kelihatannya ia sudah mati­ kepalanya dipenggal dan dikirim ke Syam, diarak kemudian diserahkan kepada Mu ’awiyah dan Mu’awiyah mengirim kepala ini kepada istrinya Aminah binti al­Syarid yang sedang berada di penjara Mu’awiyah

.

Kepala itu dilemparkan ke pangkuan istrinya. Istrinya meletakkan tangannya di dahi kepala suaminya kemudian mencium bibirnya berkata:
Mereka hilangkan dia dariku amat lama,
Mereka bunuh dan sisakan untukku kepalanya,
Selamat datang, wahai hadiah,
Selamat datang, wahai wajah tanpa roma.
‘Amr bin Hamaq adalah orang pertama dalam sejarah Islam yang kepalanya dipenggal dan diarak dari kota ke kota, lihat Ibn Qutaibah, Al­Ma’ar if, hlm. 127; Al­Isti’ab, Jilid 2, hlm. 404; Al­Ishabah, jilid 2, hlm. 533; Ibn Katsir, Tarikh, jilid 8, hlm. 48

.

>> Abu Dzar dengan Muawiyah

Ketika Abu Dzar “disuruh” Uthman untuk ke Syria, ia malah melihat kegiatan Muawiyah lebih buruk dari Uthman dan Marwan. dan tak henti-hentinya ia berdakwah dan menegur ketidakberesan dalam pemerintahan Uthman. Ia pun dipanggil Muawiyah, Muawiyah berkata, Wahai musuh Allah! engkau menghasut orang menentang aku dan berbuat sesukamu. Apabila aku sampai membunuh sahabat nabi tanpa izin khalifah maka engkaulah orangnya.” Abu Dzar pun menjawab, “Saya bukan musuh Allah atau nabi-Nya. Justru kau dan ayahmulah yang musuh Allah. Kamu berdua masuk Islam secara lahiriah, sementara kekafiran masih tersembunyi dalam hatimu.” Ia tidak memperdulikan ancaman Muawiyah dan terus berdakwah kepada masyarakat Syria. Muawiyah lantas melaporkan kegiatan Abu Dzar pada Uthman

.

Motif Revolusi Husein
.
Ada banyak motif untuk revolusi Huseiniyah dan yang paling menonjol yang bersifat ideologis. Berikut ini adalah rinciannya:
.
Diantara banyak alasan, maka dekadensi moral umat Islam adalah yang paling mendesak untuk dipulihkan. Karena adanya suatu upaya sistematis untuk mendistorsi konsep-konsep dan gagasan Islam. Pemalsuan hadis adalah perilaku dan rahasia umum, yang memiliki efek beracun pada kehidupan kaum muslimin.
.
Kedok agama yang digunakan untuk menyembunyikan perilaku jahat dinasti Bani Umayah sangat membahayakan Islam sebagai agama. Dalam jangka panjang, hal ini bisa mengubah konsepkonsep Islam yang murni dan menjungkirbalikkan cita-cita sosial Islam. Oleh karena itu, ikhtiyar untuk menanggalkan topeng ini dan mengekspos citra  Bani Umayah sesungguhnya adalah suatu kebutuhan mendesak dan penting.
.
Struktur pemerintahan tidak dibangun atas konsep dasar Islam. Klaim kaum Quraisy bahwa mereka dilahirkan untuk memerintah dan non-Arab adalah warga negara kelas dua. Ini menunjukkan bagaimana gambaran struktur sosial  dari dunia Islam di bawah dinasti Bani Umayah. Kebebasan berpikir dan berekspresi ditolak. Ketika seseorang berani untuk mengungkapkan pendapat yang bertentangan dengan penguasa, maka penjara Umayyah akan
menjadi rumahnya, hartanya dirampok, dan bahkan hidupnyadipertaruhkan.
.
Dinasti Bani Umayah menganggap kekuasaan Islam menjadi property right mereka. Sejumlah kewajiban pajak-pajak Islam seperti sedekah, zakat dan pajak Islam lainnya dikumpulkan, namun dilarang mempertanyakan kemana uang itu dibelanjakan. Gratifikasi dan penyuapan diberikan kepada gubernur dan kepala suku dalam rangka menjamin loyalitas mereka. Sejumlah besar uang dihamburkan dengan sia-sia untuk balapan, perjudian, industri khamr, dan membeli budak perempuan untuk menghibur kaum aristokrat Umayah. Oleh karena itu, sementara mayoritas muslim bisa mati karena kelaparan, sisi lain kelompok yang berkuasa menikmati hak istimewa sosial dan material.
.
Pada titik kulminasinya seiring dengan berjalannya waktu, kaum muslimin telah terbiasa dengan regulasi anti-Islam model Bani Umayyah. Beberapa perlawanan dengan mudah ditaklukkan dan akhirnya beberapa kelompok umat mulai menyesuaikan diri dengan kondisi yang ada. Oleh karena itu, semangat revolusioner Islam mulai hilang secara bertahap dari kehidupan kaum muslimin. Oleh karenanya maka diperlukan stimulan baru untuk memompa jiwa dan memulihkan kembali kehidupan beragama mereka.
.
Pentahapan Revolusi
.
Deklarasi Imam Husain untuk melawan rezim Bani Umayyah tidak diragukan lagi. Selama perjalanan ke Karbala, ia tidak pernah berhenti mengajak orang untuk berjuang untuk menuntut citacita keadilan Islam, dan untuk berperang melawan penyimpangan perilaku. Dalam sambutannya di Karbala, dia mengutip ucapan Nabi (saww) yang mengatakan :
.
“Barangsiapa yang melihat penguasa kejam, melanggar hukum Allah, melanggar hukum-Nya, bertindak menyalahi sunah Nabi, kemudian dia tidak mencoba untuk mengubah penguasa itu dengan tindakan atau lisannya, maka Allah berjanji memberikan tempat yang layak di Neraka”
.
“Kini orang-orang Bani Umayyah telah berjanji setia kepada Iblis dan meninggalkan ketaatan kepada Allah.. Mereka telah menyebar korupsi, menangguhkan penerapan hukum Islam, dan merampas harta kaum muslimin untuk diri mereka sendiri. Mengharamkan yang dihalalkan dan menghalalkan apa yang diharamkan.
.
“Pidato Imam Husain bertujuan untuk membuka kedok agama rezim Umayyah itu. Beliau memperkenalkan dirinya kepada orangorang dan menyampaikan pesan kepada umat Islam. Kepribadian Imam Husain dan reputasi agamanya tidak perlu dipertanyakan. Maka tak heran kalau beliau membawa tugas besar, sementara orang banyak yang tidak siap untuk menyambutnya.
.
Suatu keunikan dari revolusi besar ini adalah bahwa Imam Husein as. Adalah  pemimpin yang telah memprediksi kematiannya sendiri bahkan sebelum menginjakkan kaki untuk melangkah. Namun beliau terus melaksanakan segala persiapan yang diperlukan dan berkampanye. Diantara pernyataan Imam Husain kepada orangorang di Mekah adalah:
“…Sebaik-baik hal bagiku adalah kematian yang akan kualami  Wahai manusia, aku melihat seolah-olah tubuhku akan dicabikcabik oleh serigala buas diantara Al-Nawasis dan Karbala. Lalu mereka mengisi kantong-kantong mereka yang kosong. Tidak ada lagi tempat pelarian dari kejaran takdir…”
.
Imam Husain dan para sahabatnya yang mulia berjuang dengan keberanian yang tiada banding. Pasukan beliau hanya tujuh puluh berjuang melawan ribuan orang dari tentara Yazid dengan pertempuran yang tidak seimbang. Tentara Umayyah menggunakan metode yang paling kejam dan tercela dalam memerangi kafilah kecil ini. Tentara Yazid telah mencegah kafilah ini dari air minum selama tiga hari, dan menyiksanya dalam panasnya padang pasir. Namun keteguhan iman Imam Husain as. dan pengikutnya tidak goyah dalam perjuangannya. Imam telah menyalakan api yang selalu bersinar dengan jihad melawan penyimpangan Islam dan menghancurkan mitos tentang kewajiban kesetiaan kepada rezim Umayyah yang menyimpang.
.
Hasil Revolusi Imam Husein as.
.
Apa maksud hasil revolusi Imam Husain? Banyak orang yang tidak paham dengan motivasi kebangkitan Imam Husein, dengan polosnya bertanya tentang hasil revolusi Imam Husein. Bahkan mempertanyakan keputusan Imam untuk melawan rezim Umayah yang dianggapnya sia-sia dan fatal.

.

Meskipun motif revolusi sudah dibahas, tapi disini kita dapat melihat secara singkat tentang perubahan yang terjadi di dunia Islam akibat revolusi Imam Husain sesuai pada tahapan ini :
.
Pembunuhan Imam Husain as. cucu Nabi adalah skandal besar bagi seluruh dunia Islam. Apalagi cara pembunuhan dan perlakuan yang diberikan kepada keluarganya yang memiliki derajat mulia. Akibatnya, mayoritas kaum muslimin berlepas diri dari perbuatan dan kebijakan rezim Umayyah. Dengan demikian, revolusi ini telah menjalankan tugas untuk mengungkap karakter rezim Umayyah yang jauh dari tuntunan Islam kepada masyarakat umum dan kini kaum muslimin tidak meragukan lagi tentang hakekat rezim Umayyah itu. Sebab program rezim Umayyah dalam rangka mendistorsi cita-cita Islam tidak mendapatkan animo lagi.
.
Revolusi Imam Husain telah membuka jalan untuk tugas umat Islam kedepan. Penderitaan panjang umat Islam berubah menjadi pertobatan massal dan kemudian ke pemberontakan terbuka terhadap rezim Bani Umayah itu. Dengan demikian, revolusi Imam Husein telah memberikan stimulan untuk memindahkan semangat dan mengaturnya dalam gerakan yang dinamis. Kemudian  gelombang gerakan Islam terjadi sepanjang sisa sejarah Islam. Serangkaian revolusi terealisasi berkat semangat revolusioner Imam Husain dan reformasi muncul pada interval waktu yang berurutan.
.
Dalam kesempatan ini kami menutup pembahasan ini dengan mengutip pandangan Syahid Murtadha Muthahari tentang keberhasilan yang dicapai dari kebangkitan Imam Husein ; “Akan tetapi, syahadah Imam Husain meniupkan hawa segar pada dunia Islam, mewujudkan perkembangan dahsyat dalam Islam. Dampak sosial ini karena Imam Husain as telah membangkitkan roh muslimin melalui gerakan kesyahidan. Beliau  telah menghidupkan tradisi syahadah di tengah masyarakat Islam, dan mengurangi perbudakan  yang mendominasi sejak akhir priode kepemimpinan Utsman dan memuncak pada zaman Muawiyah serta anaknya. Beliau  telah merubah perasaan takut menjadi berani. Singkatnya, bahwa beliau telah menganugerahkan identitas Islam pada masyarakat muslim.”

.

Sebagai penutup dapat disimpulkan bahwa tugas utama dan misi Imam Husein as. adalah untuk membangkitkan umat dan untuk membuat mereka menyadari bahwa kesialan sedang menunggu mereka jika tidak memiliki kepedulian atas nasib umat Islam. Misinya bukan hanya sekedar untuk mereformasi pemerintahan rezim despotis Umayah. Akan tetapi Imam Husain, bersama dengan nenek moyangnya membawa misi yang unik namun universal, yaitu: untuk melawan kebodohan dan menyelamatkan orang-orang agar tidak tersesat.

Syiah Memuji Sahabat (5)

Hujr ibn Adi

Hujr ibn Adi (Arabicحجر بن عدي ‎) (d.660) was a supporter of Ali ibn Abi talib,
Aksi teror terhadap umat Islam dijalankan terhadap mereka yang tidak memberikan konsensus atas otoritas politis Muawiyah. Teror dilakukan secara terorganisir melalui jaringan aparatur pemerintahan dan pejabat-pejabat gubernur di beberapa wilayah kekuasaannya. Teror ini  dilakukan dengan cara intimidasi, pemenjaraan, pembunuhan hingga peperangan.
.
Sementara pembunuhan tanpa alasan yang sah, dalam Islam memang merupakan kejahatan fatal, sebagaimana dalam ayat QS: 5;32 oleh karena itu Kami tetapkan (suatu hukum) bagi Bani Israil, bahwa: Barangsiapa yang membunuh seorang manusia, bukan karena orang itu (membunuh) orang lain atau bukan karena membuat kerusakan dimuka bumi, Maka seakan-akan Dia telah membunuh manusia seluruhnya dan Barangsiapa yang memelihara kehidupan .seorang manusia, Maka seolah-olah Dia telah memelihara kehidupan manusia semuanya. dan Sesungguhnya telah datang kepada mereka Rasul-rasul Kami dengan (membawa) keterangan-keterangan yang jelas, kemudian banyak diantara mereka sesudah itu  sungguh sungguh melampaui batas dalam berbuat kerusakan dimuka bumi.
.
Seperti kebanyakan penguasa otoriter, maka dinasti muawiyah pun membutuhkan pemerintahan yang kuat. Untuk tujuan ini maka umat Islam dipaksa untuk mendukung, menyokong dan jika perlu memuja otoritas muawiyah. Disisi lain, terhadap rakyat dipaksa untuk membantu menyingkirkan, mendiskreditkan dan menjatuhkan siapapun yang mengganggu otoritas muawiyah. Dalam sejarah disebutkan bahwa telah terjadi propaganda anti Imam Ali as. Dengan melakukan penghujatan dalam tiap akhir mimbar jum’at di masjid-masjid dalam wilayah kekuasaan mu’awiyah.
.
Salah satu skandal pembunuhan tokoh penting – terhadap sahabat nabi yang sangat dihormati – adalah pembunuhan terhadap Hujr ibn Adi dan para pengikutnya. Latar belakang pembunuhan tersebut adalah suatu upaya untuk menyingkirkan pengaruh Imam Ali as. Dan pengikutnya (syi’ah Ali), agar “stabilitas” pemerintahan dapat terkendali. Metode represif dalam pengendalian stabilitas tersebut adalah untuk menciptakan ketakutan-ketakutan dan membungkam kelompok-kelompok oposisi.
.
Hujr bin Adi bin Jabalah Al-Kindi adalah seorang sahabat yang emberani. Ia pernah menjadi utusan Rasulullah SAW. dan terjun dalam Perang Qadisiyah. Ia dibunuh bersama sahabat-sahabatnya pada tahun 51 H. (Al-‘Alam, II/169)Disebutkan ketika Hujr akan dibunuh, ia berkata, “Biarkanlah aku berwudhu.”
.
Mereka menjawab, “Berwudhulah.”
.

Kemudia ia berkata, “Biarkanlah aku melaksanakan shalat dua rakaat.” Maka ia pun melaksanakan shalat dua rakaat pendek. Kemudian ia berkata, “Sekiranya aku tidak khawatir mereka akan mengatakan bahwa aku cemas karena akan mati, niscaya aku akan memanjangkan kedua rakaat shalat tersebut.” Ia melanjutkan, “Kedua rakaat tersebut telah didahului banyak shalat.”Kemudian mereka menggiringnya utnuk dibunuh. Mereka telah menggali kubur dan menyiapkan kafan untuknya dan sahabat-sahabatnya. Kemudia dikatakan kepdanya, “Engkau telah berkata bahwa engkau tidak gentar.”

Hujr menjawab, “Aku tidak akan gentar walaupun telah kulihat kubur yang telah tergali, kafan yang telah terbentang, dan pedang yang telah terhunus!

Kemudian seroang algojo maju ke hadapannya dan berkata, “Ulurkan lehermu!”

Ia menjawab, “Aku tidak akan membantu pembunuhan terhadap diriku.”

Maka algojo itu memenggal dan membunuhnya.

Pada hari ke 19 Ramadhan, Amirul Mukminin Imam Ali as sulit berbicara akibat racun yang bersarang dalam dirinya, dan beliau berkata, “Singkatkanlah pertanyaan-pertanyaan kalian.”

Hujur bin Adhi berkata, “Aku berdiri dan mengungkapkan syair kepada Imam Ali as,
Alangkah malangnya sang pemuka kaum takwa, ayah para manusia suci, sang Haidar yang suci (jiwanya) !

.
Orang kafir yang nista, pezina, terkutuk, fasik turunnya, celakalah yang telah membunuhnya.
Laknat Allah bagi yang berpaling dari kalian (wahai Ahlulbayt) dan yang berlepas diri dari kalian dengan laknat yang amat dahsyat

.
Karena kalian pada hari Mahsyar adalah bekalku, dan kalian Itrah Sang Nabi pemberi hidayah.

Mendengar syair Hujur ini, Imam Ali as menatapnya seraya berkata, “Bagaimanakah jadinya engkau nanti, yang pada saat itu, engkau akan dipaksa untuk berlepas diri dariku?”

Hujur menjawab,”Aku bersumpah demi Allah, seandainya aku dicincang dengan pedang lalu dibakar, aku tidak akan berpaling darimu.”

Imam Ali as berkata,”Semoga Allah memberimu balasan yang baik dan taufik dalam setiap kebaikan.”

Hujr bin Adi al Adbar adalah seorang sahabat Rasulullah (saww) dan salah satu pengikut sejati Imam Ali (as). Muawiyah Laknatullah telah memerintahkan pengikutnya (Laknatullah untuk mereka) membunuh Hujr bin Adi al Adbar. Hujr merupakan salah seorang sahabat Rasulullah (saww) yang tidak terima jika Imam Ali (as) dihina dengan cara apapun. Ibn Ziyad Laknatullah menyarankan kepada Muawiyah Laknatullah untuk menangkap Hujr dan sahabat-sahabatnya. Saat perjalanan ke Damaskus, Muawiyah Lakanatullah memerintahkan agar mereka dibunuh.

Ulama Mazhab Hanafi, Kamaluddin Umar ibn al Adim mencatat dalam Bughyat al Talib fi Tarikh Halab juz.2 hal.298 :

“Dia (Hujr bin Adi al Adbar) adalah penduduk Kufah, ia datang menemui Rasulullah (saww) sbg utusan (dr Kufah) dan dia salah seorang perawi dari (jalur) Ali bin Abi Thalib”

Hujr bin Adi al Adbar ikut serta dalam perang Jamal dan Sifin disisi Ali dan dia termasuk dalam syiah-nya. Ia telah dibunuh atas perintah Muawiyah di desa Mriaj Adra dekat Damaskus. Pada saat akan dibunuh ia meminta ; “Jgn singkirkan rantai ini setelah aku terbunuh, bgtu juga jgn bersihkan darahnya. Kami akan bertemu dg Muawiyah dan akan ku laporkan penentanganku terhadapnya” (Al Isaba, juz.1 halm.313 “Dzikr Hujr bin Adi”).

Aisyah berkata :

“Muawiyah..! kau telah membunuh Hujr dan sahabat-sahabatnya, Demi Allah, Rasul (saww) berkata kepadaku ; “Di lembah Adra tujuh orang akan terbunuh, yg membuat Allah dan seluruh (isi) langit murka”
(Tarikh, olh ibn Asakir, juz. 12 hal.227 “Dzikr Hujr bin Adi”)

“Hujr dan sahabat-sahabatnya ditangkap dan dibawa ke lembah Adra yang dekat dengan damaskus. Muawiyah memerintahkan bahwa hujr dan sahabat-sahabatnya hrs dibunuh dilembah tsb.”
(asad-ul-Ghaba, juz.1 hal. 244 “Dzikr Hujr bin Adi”)

Ibn Qutayba Dinwari (213-276 H) mencatat dalam karyanya yg masyhur “Al Ma’arif’”hal 76 :
Ia datang kepada Rasulullah saw sebagai utusan dan masuk Islam, ia hadir dalam perang Qadsiya, ia juga hadir dalam perang Jamal dan Sifin bersama Ali, lalu Muawiyah membunuhnya di Adra bersama kelompoknya”

Ulama mazhab Syafi’i, Allamah Hibatullah Lalkai (w.418) mencatat dalam “Syarh Usul Itiqad Ahlu Sunnah” Juz. 7 hal. 18 :
“Apa yang telah diriwayatkan mengenai karamah Hujr bin Adi atau Qais Makhshus seorang sahabat Rasulullah (saw)”

Imam Ali (as) bicara mengenai Hujr bin Adi :

Tercatat bahwa Imam Ali meramalkan terbunuhnya Hujr, hal ini oleh Allamah Muttaqi al Hindi dicatat dalam “Kanzul-Ummal” :
(Imam) Ali berkata “Hai orang-orang Kufah..! tujuh orang terbaik di antara kalian akan terbunuh, perumpamaan mereka sama dengan orang beriman di lembah”. Hujr bin Adi al Adbar dan sahabat-sahabatnya berada diantara mereka, dan mereka berasal dari Kufah, Muawiyah membunuh mereka di Adra perbatasan Damaskus”
(Kanzul Umal, Juz. 13 hal.531 riwayat 36530)

Pernah juga Aisyah bertanya kepada Muawiyah, (Kanzul Ummal juz.13 hal.556 riwayat 37510) :
Abi al Aswad meriwayatkan bahwa Muawiyah menemui Aisyah, dan Aisyah bertanya kepadanya ;
“Mengapa kau bunuh orang-orang Adra” (mksdnya Hujr dan sahabatnya).
Muawiyah menjawab : “Wahai Umul Mukminin, Aku melihat bahwa kematian mereka lebih baik untuk umat dan hidupnya mereka akan membawa kerugian umat”
Ia (Aisyah) berkata : “Aku mendengar Rasulullah (saww) berkata : “Beberapa orang akan terbunuh di Adra, Allah dan penduduk surga akan murka karena hal itu”

Untuk para Nashibi (wahabi) Muawiyah adalah orang yang mulia, mereka menyanjung Muawiyah dan mengatakan dia adalah Khalifah Muslim, menyebut “Radhiallahu Anhu” setelah menyebut namanya…!

Sejarah dipaparkan sangat jelas bahwa Muawiyah telah membuat Allah Murka, bukan hanya dalam kasus yang ini, ia adalah pembenci Ahlul Bait (as) yang masuk dalam al Ahzab 33. Tidak diragukan lagi bahwa Muawiyah adalah orang yang pantas dilaknat..!

Dalam Al Bidayah wal Nihayah juz. 8 hal.55 disebutkan bahwa :
“Ibn Asakir mencatat bahwa Hujr datang kepada Rasulullah (saw) dan mendengar (hadis) dari Ali, ammar, Syarajil bin Marat yang dikenal dengan Syarjil bin Marat”

Al Hakim dalam Mustadrak membuat bab khusus tentang Hujr bin Adi (ra), “Keutamaan Hujr bin Adi (ra) dan Ia seorang sahabat Muhammad saw (Manaqib Hujr bin Adi wa huwa asahab Muhammad” (Al Mustadrak Sahihain Juz.3 hal.468)

Jika orang berdalih bahwa Muawiyah adalah “sahabat” Rasul (saww) dan oleh karenanya ia tidak boleh dilaknat, siapapun yang mengatakan hal tersebut, lihatlah bahwa Muawiyah adalah pembunuh sahabat Rasulullah (saww) yang sekaligus pengikut Imam Ali (as), maka cukup bagi kami bahwa murka Allah kepada Muawiyah membebaskan kami untuk melaknat orang terkutuk ini.

“Sesungguhnya orang-orang yang menyimpan apa yang Kami turunkan berupa keterangan-keterangan dan petunjuk, setelah Kami menerangkannya kepada manusia dalam Al Kitab, mereka itu dilaknat oleh Allah dan dilaknat oleh semua makhluk yang dapat melaknat. Kecuali mereka yang telah bertaubat dan melakukan perbaikan dan menerangkan kebenaran, mereka itu Akulah Yang Maha menerima taubat lagi Maha Penyayang.”(Al-Baqarah ;159-160)

Demi Allah, saya lebih suka melewatkan suatu malam dalam jaga di atas duri-duri as-sa’dân (tumbuhan yang mempunyai duri-duri lancip) atau digiring dalam keadaan terbelenggu sebagai tawanan daripada menemui Allah dan Rasul-Nya di Hari Pengadilan sebagai penindas terhadap seseorang atau sebagai penyerobot (koruptor) sesuatu dari kekayaan dunia. Dan bagaimana saya dapat menindas sesorang demi (suatu kehidupan) yang begerak cepat ke arah kehancuran dan akan tinggal di bawah bumi untuk waktu lama.

Demi Allah, saya sungguh melihat (saudara saya) ‘Aqîl jatuh dalam kemiskinan dan ia meminta kepada saya satu sha’ (seberat kka-kira 3 kg) (dari bagian) gandum Anda, dan saya pun melihat anak-anaknya dengan rambut kusut dan wajah berdebu karena kelaparan, seakan-akan wajah mereka dihitamkan oleh nila. la datang kepada saya beberapa kali dan mengulangi permohonannya berkali-kali. Saya mendengarkannya dan ia berpikir seakan-akan saya mau menjual iman saya kepadanya dan mengikuti langkahnya dengan meninggalkan jalan saya sendiri. Kemudian saya (hanya) memanaskan sepotong besi dan mendekatkannya ke tubuhnya supaya ia boleh mengambil suatu pelajaran dari hal itu, lalu ia menangis sebagai seseorang dalam keadaan sakit yang berkepanjangan menangis karena kesakitan dan ia sudah hampir terbakar dengan besi panas itu. Kemudian saya berkata kepadanya, “Perempuan-perempuan berkabung boleh berkabung atas Anda, wahai ‘Aqîl. Apakah Anda menangis karena besi (panas) ini yang telah dibuat oleh seorang manusia sebagai main-main, sementara Anda mendorong saya ke arah api yang dipersiapkan Allah Yang Mahakuasa untuk (perwujudan) kemurkaan-Nya? Haruskah Anda menangis karena sakit tetapi saya tak boleh menangis karena api?

Suatu kejadian yang lebih aneh lagi dari ini ialah seorang lelaki [Al-Asy’ats ibn Qais] datang kepada kami di malam hari dengan botol tertutup yang penuh dengan pasta madu [sesuatu yg mahal], tetapi saya tidak menyukainya, seakan itu adalah liur atau muntah ular. Saya tanyakan kepadanya apakah itu suatu ganjaran, atau zakat atau sedekah, karena hal-hal ini terlarang bagi kami para anggota keluarga Nabi. la katakan hal itu bukan ini dan bukan itu melainkan suatu hadiah. Kemudian saya berkata, “Perempuan tak beranak boleh menangisi Anda. Apakah Anda datang untuk menyelewengkan saya dari agama Allah, atau apakah Anda gila, ataukah Anda telah ditaklukkan oleh suatu jin, atau apakah Anda berbicara tanpa makna?”

Demi Allah, sekalipun saya diberi semua wilayah tujuh (lapis langit) dengan segala yang ada di bawahnya agar saya melanggar perintah Allah dengan sekadar merebut sebutir gandum murahan dari seekor semut, saya tidak akan melakukannya. Bagi saya dunia Anda lebih enteng dari daun di mulut belalang yang sedang mengunyahnya. Apa hubungan ‘Ali dengan hadiah yang akan lewat dan kesenangan yang tidak akan langgeng? Kami memohon perlindungan Allah dari tergelincimya kebijaksanaan dan jahatnya kekeliruan, dan dari Dia kami mengharap pertolongan. •

Nahjul Balaghah Khotbah 222

Muawiyah Membunuh Sahabat Nabi Hujr bin Adi

Di antara salah satu penyimpangan yang dilakukan Muawiyah adalah perbuatannya yang membunuh salah seorang Sahabat Nabi yaitu Hujr bin Adiy Al Kindi RA. Hujr bin Adi adalah sahabat Nabi yang setia kepada Imam Ali AS, beliau bersama Imam Ali baik dalam perang Jamal maupun perang Shiffin. Para Ahli sejarah dan biografi rijal menyebutkan bahwa Hujr bin Adi dan para sahabatnya diperintahkan oleh Muawiyah untuk dieksekusi di desa Azra’ salah satu wilayah di Syam.

Ibnu Hajar menyebutkan biografi Hujr bin Adi dalam kitabnya Al Ishabah Fi Tamyiz As Shahabah 2/37 no 1631. Ibnu Abdil Barr dalam kitabnya Al Isti’ab 1/329 dan Ibnu Atsir dalam Usud Al Ghabah 1/565 mengatakan bahwa Hujr bin Adi salah seorang sahabat Nabi yang utama. Ibnu Atsir berkata dalam biografi Hujr

وشهد القادسية وكان من فضلاء الصحابة

Dia ikut dalam perang Qadisiyah dan dia salah seorang dari sahabat Nabi yang utama.

Selain itu Ibnu Atsir juga berkata tentang Hujr

فأنزل هو وأصحابه عذراء وهي قرية عند دمشق فأمر معاوية بقتلهم

Dia dan sahabatnya sampai di Adzra’ sebuah desa di Damasykus dan Muawiyah memerintahkan untuk membunuh mereka.

Al Hakim dalam Al Mustadrak 3/468 menuliskan Hujr dalam kitab Ma’rifat As Shahabah dengan judul

ذكر مناقب حجر بن عدي رضى الله تعالى عنه

وهو راهب أصحاب محمد صلى الله عليه وسلم

Keutamaan Hujr bin Adi Radiallahuta’ala anhu dan dia rahib sahabat Muhammad Shalallahualaihi wassalam.

Adz Dzahabi dalam Siyar A’lam An Nubala 3/463 menyebutkan biografi Hujr bin Adi dan ia berkata “lahu sahabah” yang artinya dia seorang Sahabat Nabi SAW. Adz Dzahabi juga memasukkan nama Hujr bin Adi dalam kitabnya Tajrid Asma As Shahabah 1/123 no 1264 dan berkata Adz Dzahabi dalam Tarikh Al Islam 4/33

حجر بن عدي حجر الخير. له وفادة على النبي صلى الله عليه وسلم فأسلم

Hujr bin Adiy Hujr Al khayr dia utusan yang datang kepada Nabi SAW dan memeluk islam.

Khairuddin Az Zarkali dalam kitabnya Al ‘Alam 2/169 menyebutkan biografi Hujr bin Ady

حجر بن عدي بن جبلة الكندي  ويسمى حجر الخير  صحابي شجاع  من المقدمين  وفد على رسول الله صلى الله عليه وسلم وشهد القادسية  ثم كان من أصحاب علي وشهد معه وقعتي الجمل وصفين

Hujr bin Ady bin Jabalah Al Kindi Hujr Al Khayr seorang Sahabat yang gagah berani dari golongan terdahulu. Dia utusan yang datang kepada Nabi SAW ikut dalam perang Qadisiyah dan dia juga sahabat Ali berada di sisinya pada saat perang  Jamal dan Shiffin.

Az Zarkali juga berkata

فأمر معاوية بقتله في مرج عذراء ( من قرى دمشق ) مع أصحاب

Muawiyah memerintahkan membunuhnya di Azra’ (suatu desa di damasykus) bersama para sahabatnya.

Ibnu Qutaibah Al Dinawari dalam kitabnya Al Ma’arif hal 148 menyebutkan biografi Hujr bin Ady

حجر بن عدي رضي الله تعالى عنه

هو الذي قتله معاوية ويكنى أبا عبد الرحمن وكان وفد إلى النبي صلى الله عليه وسلم وأسلم وشهد القادسية وشهد الجمل وصفين مع علي، فقتله معاوية بمرج غدراء مع عدة

Hujr bin Adiy Radiallahuta’ala anhu, dia dibunuh oleh Muawiyah. Kuniyahnya Abu Abdurrahman, dia seorang utusan yang datang kepada Nabi SAW dan memeluk islam. Ikut dalam perang Qadisiyah, mengikuti perang Jamal dan Shiffin bersama Ali, Muawiyah membunuhnya di Azra’ bersama beberapa sahabatnya.